Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 5zji Chain C Binding Site BS01

Receptor Information >5zji Chain C (length=81) Species: 381124 (Zea mays subsp. mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVG CKRCESACPTDFLSVRVYLGPETTRSMALSY

Ligand information Ligand ID SF4 InChI InChI=1S/4Fe.4S InChIKey LJBDFODJNLIPKO-UHFFFAOYSA-N SMILES Software SMILES OpenEye OEToolkits 2.0.7 [S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45 CACTVS 3.385 S1[Fe]S[Fe]1.S2[Fe]S[Fe]2 Formula Fe4 S4 Name IRON/SULFUR CLUSTER ChEMBL DrugBank ZINC PDB chain 5zji Chain C Residue 101 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 5zji Structure of the maize photosystem I supercomplex with light-harvesting complexes I and II. Resolution 3.3 Å Binding residue (original residue number in PDB) C21 P22 V25 C48 G50 C51 K52 R53 C54 V67 Binding residue (residue number reindexed from 1) C21 P22 V25 C48 G50 C51 K52 R53 C54 V67 Annotation score 1

Enzymatic activity Enzyme Commision number 1.97.1.12: photosystem I.

Gene Ontology Molecular Function GO:0009055 electron transfer activity GO:0016491 oxidoreductase activity GO:0046872 metal ion binding GO:0051539 4 iron, 4 sulfur cluster binding

	Biological Process
GO:0009773	photosynthetic electron transport in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009534	chloroplast thylakoid
GO:0009536	plastid
GO:0009579	thylakoid
GO:0016020	membrane
GO:0042651	thylakoid membrane

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component