[Home] [Back to DMFold server] [Help]

DMFold results for DMF482643047

[Click result.zip to download all results on this page]


Input Sequence In FASTA Format

DMF482643047 ( 207 residues )
>DYT1_monomer-A
MGGGSRFQEPVRMSRRKQVTKEKEEDENFKSPNLEAERRRREKLHCRLMALRSHVPIVTNMTKASIVEDAITYIGELQNNVKNLLETFHEMEEAPPEIDEEQTDPMIKPEVETSDLNEEMKKLGIEENVQLCKIGERKFWLKIITEKRDGIFTKFMEVMRFLGFEIIDISLTTSNGAILISASVQTQELCDVEQTKDFLLEVMRSNP

  Multiple Sequence Alignments

Alignment depth: Nf=140.815, number of sequences=4180


  • Download multiple sequence alignment in aln format.
  • Download multiple sequence alignment in a3m format.
    		•

     Predicted Contact And Distance Map

    Contact Map
    		 Distance Map

     Top 5 Final Models From DMFold

    Click
    to view    		 RankDownload PDBpLDDT
    1 model1.pdb.gz 0.83
    2 model2.pdb.gz 0.83
    3 model3.pdb.gz 0.82
    4 model4.pdb.gz 0.81
    5 model5.pdb.gz 0.81

    Note: If the JSmol model is not visible, please refresh the page or click the radio buttons

    (a) DMFold generates a large set of structural models by different MSAs as inputs. These models are ranked by predicted TM-score (pTM-score for multimer) or predicted LDDT (pLDDT for monomer) and top 5 models are selected with the highest predicted scores.

     Residue-level Modeling Quality


    pLDDT of chain A


     Proteins With Similar Structure

    Top 10 structural analogs in PDB (as identified by TM-align)

    Click
    to view    		RankPDB
    Hit    		TM-scoreRMSDaIDENaCov.Download
    Alignment
    11ygyA0.404.490.080.56Download
    24binA0.395.480.090.69Download
    31m1jE0.396.010.070.72Download
    46ahd10.395.220.040.65Download
    57nfyA10.385.490.070.65Download
    65nrlJ0.385.200.030.62Download
    77y8rI0.385.120.040.61Download
    87ngcA0.385.830.050.67Download
    98hd0E0.384.730.030.58Download
    107xyyA0.375.950.070.68Download

    Note: If the JSmol model is not visible, please refresh the page or click the radio buttons

    (a)Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
    (b)Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
    (c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
    (d)IDENa is the percentage sequence identity in the structurally aligned region.
    (e)Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

    [Back to server]
    Reference:
  • Wei Zheng, Qiqige Wuyun, Yang Li, Chengxin Zhang, P Lydia Freddolino, Yang Zhang. Improving deep learning protein monomer and complex structure prediction using DeepMSA2 with huge metagenomics data. Nature Methods, (2024). https://doi.org/10.1038/s41592-023-02130-4.
  • Wei Zheng, Quancheng Liu, Qiqige Wuyun, P. Lydia Freddolino, Yang Zhang. DMFold: A deep learning platform for protein complex structure and function predictions based on DeepMSA2. In preparation.
  • Wei Zheng, Qiqige Wuyun, Peter L Freddolino, Yang Zhang. Integrating deep learning, threading alignments, and a multi-MSA strategy for high-quality protein monomer and complex structure prediction in CASP15. 1-20. Proteins. (2023). doi:10.1002/prot.26585.

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218