Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	P2Y purinoceptor 14
Species	Mus musculus (Mouse)
Gene	P2ry14
Synonym	G protein-coupled receptor 105 G-protein coupled receptor 105 GPR105 G protein coupled receptor for UDP-glucose P2Y purinoceptor 14 P2Y14 P2Y14 receptor purinergic receptor P2Y UDP-glucose receptor [ Show all ]
Disease	N/A for non-human GPCRs
Length	338
Amino acid sequence	MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL
UniProt	Q9ESG6
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL1770046
IUPHAR	330
DrugBank	N/A

Ligand

Name	UDP-glucose
Molecular formula	C15H24N2O17P2
IUPAC name	[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] hydrogen phosphate
Molecular weight	566.302
Hydrogen bond acceptor	17
Hydrogen bond donor	9
XlogP	-6.3
Synonyms	URIDINE-5'-DIPHOSPHATE-GLUCOSE C00029 D0DP9H Mono-D-glucosyl ester UNII-V50K1D7P4Y Uridine 5'-(trihydrogen diphosphate), P'-alpha-D-glucopyranosyl ester uridine 5'-[3-alpha-D-glucopyranosyl dihydrogen diphosphate] URIDINE-5'-MONOPHOSPHATE GLUCOPYRANOSYL-MONOPHOSPHATE ESTER CHEMBL375951 EINECS 205-121-4 UDP-D-glucose uridine 5''-[3-alpha-D-glucopyranosyl dihydrogen diphosphate] Uridine 5'-diphosphate glucose Uridine diphosphate-glucose Uridine pyrophosphate-glucose [[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] hydrogen phosphate BDBM50209659 Cogalactoisomerase GUD UDPG Uridine 5'-(trihydrogen diphosphate), mono-alpha-d-glucopyranosyl ester Uridine 5'-pyrophosphate glucose ester Uridine-5'-diphospho-glucose disodium salt 5''''-Diphosphoglucose CHEBI:46229 DB01861 SCHEMBL454078 UPG Uridine 5'-(trihydrogen pyrophosphate), mono-alpha-D-glucopyranosyl ester (8CI) Uridine 5-(trihydrogen diphosphate) V50K1D7P4Y co-galactoisomerase GLUCOSE-URIDINE-C1,5'-DIPHOSPHATE UDP-Glc Uridine 5'-(alpha-D-glucopyranosyl pyrophosphate) Uridine 5'-diphospho-alpha-D-glucose Uridine diphospho-D-glucose Uridine-5''''-Diphosphoglucose 133-89-1 BDBM50423218 D07MIE HSCJRCZFDFQWRP-JZMIEXBBSA-N UDPglucose Uridine 5'-(trihydrogen diphosphate), P'-a-D-glucopyranosyl ester (9CI) Uridine 5'-pyrophosphate, alpha-D-glucopyranosyl ester (6CI,7CI) URIDINE-5'-DIPHOSPHOGLUCOSE 5'-Diphosphoglucose DTXSID00157902 UDP-alpha-D-Glucose Uridindiphosphoglucose Uridine 5'-(trihydrogen pyrophosphate), mono-D-glucosyl ester URIDINE DIPHOSPHATE GLUCOSE Uridine diphosphoglucose ZINC8215472 AC1L1RDS co-waldenase GTPL1783 Uridine 5'-(trihydrogen diphosphate) alpha-D-gucopyranosyl ester Uridine 5'-diphosphoglucose [ Show all ]
Inchi Key	HSCJRCZFDFQWRP-JZMIEXBBSA-N
Inchi ID	InChI=1S/C15H24N2O17P2/c18-3-5-8(20)10(22)12(24)14(32-5)33-36(28,29)34-35(26,27)30-4-6-9(21)11(23)13(31-6)17-2-1-7(19)16-15(17)25/h1-2,5-6,8-14,18,20-24H,3-4H2,(H,26,27)(H,28,29)(H,16,19,25)/t5-,6-,8-,9-,10+,11-,12-,13-,14-/m1/s1
PubChem CID	8629
ChEMBL	CHEMBL375951
IUPHAR	1783
BindingDB	50209659, 50423218
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand has more than 5 hydrogen bond donor. This ligand has more than 10 hydrogen bond acceptor. This ligand is heavier than 500 daltons.

Experimental Data

Parameter	Value	Reference	Database source
EC50	19.9526 nM	PMID11735218	IUPHAR

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218