[Home] [Server] [Queue] [About] [Remove] [Statistics]

I-TASSER results for job id S686517

(Click on S686517_results.tar.bz2 to download the tarball file including all modeling results listed on this page. Click on Annotation of I-TASSER Output to read the instructions for how to interpret the results on this page. Model results are kept on the server for 60 days, there is no way to retrieve the modeling data older than 2 months)

  Submitted Sequence in FASTA format

>protein
MTGITGSTGATGTTGATGETGPTGSTGATGTTGATGETGPTGSTGAMGNTGATGSTGVTG
NTGSTGSTGATGSTGVTGNTGSTGSTGATGTTGATGETGATGPTGSIGAMGTTGATGETG
STGNTGPTGSTGVTGSTGPTGETGATGSTGPTGETGATGSTGPIGATGETGPTGSTGTTG
ETGSTGNTGPTGETGATGSTGVTGNTGPTGETGATGSTGPTGNTGATGNTGPTGETGATG
STGVTGNTGPTGETGPTGSTGAIGNTGPTGETGVTGETGVTGSTGPTGNTGATGSTGVTG
NTGSTGATGPTGNTGPTGSTGVTGNTGATGSTGPTGNTGATGNTGPTGETGATGSTGVTG
NTGPTGETGPTGSTGAIGNTGPTGETGVTGETGVTGSTGPTGNTGATGSTGVTGNTGSTG
ATGPTGNTGPTGSTGVTGNTGATGAIGPTGSTGPTGETGVTGPTGSTGVTGSTGPTGSTG
ATGNTGATGETGPTGNTGVTGSTGPTGETGVTGGTGPTGETGVTGSTGPTGETGVTGSTG
PTGSTGVTGNTGATGATGPTGSTGATGSTGPTGETGVTGNTGPTGETGVTGSTGVTGNTG
PTGSTGATGNTGPTGETGATGSTGVTGSTGATGNTGATGNTGATGSTGPTGNTGATGNTG
PTGNTGATGVTGSTGVTGNTGPTGETGPTGSTGATGNTGPTGETGVTGSTGPTGNTGATG
NTGPIGETGVTGSTGPTGNTGATGNTGPTGETGVTGSTGPTGSTGVTGNTGTTGSTGNTG
PTGATGSTGPTGEAGATGSTGVTGSTGPTGETGATGSTGPIGATGETGPTGETGATGSTG
VTGNTGPTGETGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGATGATGPTGSTG
AIGNTGPTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGSTGPTGETGVTGSTG
PTGSTGATGNTGPTGETGATGSTGATGNTGATGETGPTGNTGVTGSTGPTGETGVTGGTG
PTGETGVTGSTGPTGETGVTGSTGPTGSTGVTGNTGATGATGPTGSTGATGSTGPTGETG
VTGNTGPTGETGVTGSTGVTGNTGPTGSTGATGNTGPTGETGATGSTGVTGSTGATGSTG
VTGSTGATGNTGATGSTGPTGNTGATGNTGPTGETGVTGSTGPTGSTGVTGNTGTTGSTG
NTGPTGATGSTGPTGSTGATGVTGSTGPTGSTGTTGNTGVTGDTGPTGATGVSTTATYAF
ANNTSGSVISVLLGGTNIPLPNNQNIGPGITVSGGNTVFTVANAGNYYIAYTINLTAGLL
VSSRITVNGSPLAGTINSPTVATGSFSATIIASLPAGAAVSLQLFGVVALATLSTATPGA
TLTIIRLS

  Predicted Secondary Structure

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440                 460                 480                 500                 520                 540                 560                 580                 600                 620                 640                 660                 680                 700                 720                 740                 760                 780                 800                 820                 840                 860                 880                 900                 920                 940                 960                 980                1000                1020                1040                1060                1080                1100                1120                1140                1160                1180                1200                1220                1240                1260                1280                1300                1320                1340                1360                1380
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |        
MTGITGSTGATGTTGATGETGPTGSTGATGTTGATGETGPTGSTGAMGNTGATGSTGVTGNTGSTGSTGATGSTGVTGNTGSTGSTGATGTTGATGETGATGPTGSIGAMGTTGATGETGSTGNTGPTGSTGVTGSTGPTGETGATGSTGPTGETGATGSTGPIGATGETGPTGSTGTTGETGSTGNTGPTGETGATGSTGVTGNTGPTGETGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGPTGETGPTGSTGAIGNTGPTGETGVTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGNTGPTGSTGVTGNTGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGPTGETGPTGSTGAIGNTGPTGETGVTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGNTGPTGSTGVTGNTGATGAIGPTGSTGPTGETGVTGPTGSTGVTGSTGPTGSTGATGNTGATGETGPTGNTGVTGSTGPTGETGVTGGTGPTGETGVTGSTGPTGETGVTGSTGPTGSTGVTGNTGATGATGPTGSTGATGSTGPTGETGVTGNTGPTGETGVTGSTGVTGNTGPTGSTGATGNTGPTGETGATGSTGVTGSTGATGNTGATGNTGATGSTGPTGNTGATGNTGPTGNTGATGVTGSTGVTGNTGPTGETGPTGSTGATGNTGPTGETGVTGSTGPTGNTGATGNTGPIGETGVTGSTGPTGNTGATGNTGPTGETGVTGSTGPTGSTGVTGNTGTTGSTGNTGPTGATGSTGPTGEAGATGSTGVTGSTGPTGETGATGSTGPIGATGETGPTGETGATGSTGVTGNTGPTGETGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGATGATGPTGSTGAIGNTGPTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGSTGPTGETGVTGSTGPTGSTGATGNTGPTGETGATGSTGATGNTGATGETGPTGNTGVTGSTGPTGETGVTGGTGPTGETGVTGSTGPTGETGVTGSTGPTGSTGVTGNTGATGATGPTGSTGATGSTGPTGETGVTGNTGPTGETGVTGSTGVTGNTGPTGSTGATGNTGPTGETGATGSTGVTGSTGATGSTGVTGSTGATGNTGATGSTGPTGNTGATGNTGPTGETGVTGSTGPTGSTGVTGNTGTTGSTGNTGPTGATGSTGPTGSTGATGVTGSTGPTGSTGTTGNTGVTGDTGPTGATGVSTTATYAFANNTSGSVISVLLGGTNIPLPNNQNIGPGITVSGGNTVFTVANAGNYYIAYTINLTAGLLVSSRITVNGSPLAGTINSPTVATGSFSATIIASLPAGAAVSLQLFGVVALATLSTATPGATLTIIRLS
PredictionCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCSSCCCCCSSSSSCCCCCSSSSSSCCCCCCCCCCCCCCCCCCCCCCCSSCCCSSSSSSCCCCCCCCCCCCSSSSSSSCHHHHHHHHCCCCCCSSSSSSCC
Conf.Score96887888888888888888978888888888988988888988988988888888888888988888888888888988988988988888898988888988988988888888888988988988888888888988988888888887887888887888888887887888988988988887888888888888888888988988888888988988988988988888888888988988888888988888888888888877888988888888988988988888888988988888988988988888988988888888988988888888988988988888888988988888988888888888888888888888888888888888888888888888877888888888888888988988988888988888988888888888988998887988988877887888888898988888888888988988888888888888888888988988988988988888988888888988988888888888888888888888988888888888898988888888988988888887887888888888997988878888888898988988988988988888888888888888988988998888988888888988888887888888888887888888988888988888888888888988988888998887888888888888888988988888888988888888887988988988988888988988888888888888988888888888988988888988988888888988988988888888888888888988888988988888988888988888888888888888988888888888888988998988888897988888898988888888887888888888988988888888988988988888988988988988988988988888888888888888888988888888888888988988988988888888888888988987888888888888887887888888988888988888888888888887888888888988888888887988988888888998998888888888988887888888888988888988988888998888888888888876777888887775643356877873421477776667888666887525799727565179747874536787765411223456642245244053568765265453689999887885051665442047987113468559
H:Helix; S:Strand; C:Coil

  Predicted Solvent Accessibility

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440                 460                 480                 500                 520                 540                 560                 580                 600                 620                 640                 660                 680                 700                 720                 740                 760                 780                 800                 820                 840                 860                 880                 900                 920                 940                 960                 980                1000                1020                1040                1060                1080                1100                1120                1140                1160                1180                1200                1220                1240                1260                1280                1300                1320                1340                1360                1380
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |        
MTGITGSTGATGTTGATGETGPTGSTGATGTTGATGETGPTGSTGAMGNTGATGSTGVTGNTGSTGSTGATGSTGVTGNTGSTGSTGATGTTGATGETGATGPTGSIGAMGTTGATGETGSTGNTGPTGSTGVTGSTGPTGETGATGSTGPTGETGATGSTGPIGATGETGPTGSTGTTGETGSTGNTGPTGETGATGSTGVTGNTGPTGETGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGPTGETGPTGSTGAIGNTGPTGETGVTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGNTGPTGSTGVTGNTGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGPTGETGPTGSTGAIGNTGPTGETGVTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGNTGPTGSTGVTGNTGATGAIGPTGSTGPTGETGVTGPTGSTGVTGSTGPTGSTGATGNTGATGETGPTGNTGVTGSTGPTGETGVTGGTGPTGETGVTGSTGPTGETGVTGSTGPTGSTGVTGNTGATGATGPTGSTGATGSTGPTGETGVTGNTGPTGETGVTGSTGVTGNTGPTGSTGATGNTGPTGETGATGSTGVTGSTGATGNTGATGNTGATGSTGPTGNTGATGNTGPTGNTGATGVTGSTGVTGNTGPTGETGPTGSTGATGNTGPTGETGVTGSTGPTGNTGATGNTGPIGETGVTGSTGPTGNTGATGNTGPTGETGVTGSTGPTGSTGVTGNTGTTGSTGNTGPTGATGSTGPTGEAGATGSTGVTGSTGPTGETGATGSTGPIGATGETGPTGETGATGSTGVTGNTGPTGETGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGATGATGPTGSTGAIGNTGPTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGSTGPTGETGVTGSTGPTGSTGATGNTGPTGETGATGSTGATGNTGATGETGPTGNTGVTGSTGPTGETGVTGGTGPTGETGVTGSTGPTGETGVTGSTGPTGSTGVTGNTGATGATGPTGSTGATGSTGPTGETGVTGNTGPTGETGVTGSTGVTGNTGPTGSTGATGNTGPTGETGATGSTGVTGSTGATGSTGVTGSTGATGNTGATGSTGPTGNTGATGNTGPTGETGVTGSTGPTGSTGVTGNTGTTGSTGNTGPTGATGSTGPTGSTGATGVTGSTGPTGSTGTTGNTGVTGDTGPTGATGVSTTATYAFANNTSGSVISVLLGGTNIPLPNNQNIGPGITVSGGNTVFTVANAGNYYIAYTINLTAGLLVSSRITVNGSPLAGTINSPTVATGSFSATIIASLPAGAAVSLQLFGVVALATLSTATPGATLTIIRLS
Prediction46444444334344246145135246246245346345146145144246245145146145145155145144146246146246145144145254444246145146146146145244145145145246246145265246346146244145244144146244145146246246246365246245145145146345246245246255145245246245245344245345246366146145144246246145145245145145146246346365246245146344146344445244146145146254444245146346146146145245145145246246246245245146145245145146145144245145145145146145245345156246245245146145246244146245246344144265246144144246154245244246144245245146144145245246245145244145146245246144344246245145145246145145244245145146246145245245245245145146145246255146245246245246245244145246145145145145245245346246245145144145245245145245245265145244135144245246246244246246145144246246245165245244145145246144145245245245145344135144244244145144146245146145145245146245245254246244145245244246245146245246246145245245245146145245256246255245145246165145245145146145145145145346144146256244146344345244444235146146145246145145145246356146245346155145246244145144244146144145244245245145344346146145244146244245144246144344246246146146245245145346245145245245145145144145144245144135144244022224244144245146145245345345245144245245146245145346146145246246144245245146145144145246244244146145145145144244246145134114113343012115234132112113134113333331000010132200000000110000000110010100141111010112331320101000000100411300310111100101001011012011030137
Values range from 0 (buried residue) to 9 (highly exposed residue)

   Predicted normalized B-factor

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. Click here to read more about predicted normalized B-factor)


  Top 10 threading templates used by I-TASSER

(I-TASSER modeling starts from the structure templates identified by LOMETS from the PDB library. LOMETS is a meta-server threading approach containing multiple threading programs, where each threading program can generate tens of thousands of template alignments. I-TASSER only uses the templates of the highest significance in the threading alignments, the significance of which are measured by the Z-score, i.e. the difference between the raw and average scores in the unit of standard deviation. The templates in this section are the 10 best templates selected from the LOMETS threading programs. Usually, one template of the highest Z-score is selected from each threading program, where the threading programs are sorted by the average performance in the large-scale benchmark test experiments.)

Rank PDB
Hit
Iden1Iden2CovNorm.
Z-score
Download
Align.
                   20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440                 460                 480                 500                 520                 540                 560                 580                 600                 620                 640                 660                 680                 700                 720                 740                 760                 780                 800                 820                 840                 860                 880                 900                 920                 940                 960                 980                1000                1020                1040                1060                1080                1100                1120                1140                1160                1180                1200                1220                1240                1260                1280                1300                1320                1340                1360                1380
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |        
Sec.Str
Seq
CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCSSCCCCCSSSSSCCCCCSSSSSSCCCCCCCCCCCCCCCCCCCCCCCSSCCCSSSSSSCCCCCCCCCCCCSSSSSSSCHHHHHHHHCCCCCCSSSSSSCC
MTGITGSTGATGTTGATGETGPTGSTGATGTTGATGETGPTGSTGAMGNTGATGSTGVTGNTGSTGSTGATGSTGVTGNTGSTGSTGATGTTGATGETGATGPTGSIGAMGTTGATGETGSTGNTGPTGSTGVTGSTGPTGETGATGSTGPTGETGATGSTGPIGATGETGPTGSTGTTGETGSTGNTGPTGETGATGSTGVTGNTGPTGETGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGPTGETGPTGSTGAIGNTGPTGETGVTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGNTGPTGSTGVTGNTGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGPTGETGPTGSTGAIGNTGPTGETGVTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGNTGPTGSTGVTGNTGATGAIGPTGSTGPTGETGVTGPTGSTGVTGSTGPTGSTGATGNTGATGETGPTGNTGVTGSTGPTGETGVTGGTGPTGETGVTGSTGPTGETGVTGSTGPTGSTGVTGNTGATGATGPTGSTGATGSTGPTGETGVTGNTGPTGETGVTGSTGVTGNTGPTGSTGATGNTGPTGETGATGSTGVTGSTGATGNTGATGNTGATGSTGPTGNTGATGNTGPTGNTGATGVTGSTGVTGNTGPTGETGPTGSTGATGNTGPTGETGVTGSTGPTGNTGATGNTGPIGETGVTGSTGPTGNTGATGNTGPTGETGVTGSTGPTGSTGVTGNTGTTGSTGNTGPTGATGSTGPTGEAGATGSTGVTGSTGPTGETGATGSTGPIGATGETGPTGETGATGSTGVTGNTGPTGETGATGSTGPTGNTGATGNTGPTGETGATGSTGVTGNTGATGATGPTGSTGAIGNTGPTGETGVTGSTGPTGNTGATGSTGVTGNTGSTGATGPTGSTGPTGETGVTGSTGPTGSTGATGNTGPTGETGATGSTGATGNTGATGETGPTGNTGVTGSTGPTGETGVTGGTGPTGETGVTGSTGPTGETGVTGSTGPTGSTGVTGNTGATGATGPTGSTGATGSTGPTGETGVTGNTGPTGETGVTGSTGVTGNTGPTGSTGATGNTGPTGETGATGSTGVTGSTGATGSTGVTGSTGATGNTGATGSTGPTGNTGATGNTGPTGETGVTGSTGPTGSTGVTGNTGTTGSTGNTGPTGATGSTGPTGSTGATGVTGSTGPTGSTGTTGNTGVTGDTGPTGATGVSTTATYAFANNTSGSVISVLLGGTNIPLPNNQNIGPGITVSGGNTVFTVANAGNYYIAYTINLTAGLLVSSRITVNGSPLAGTINSPTVATGSFSATIIASLPAGAAVSLQLFGVVALATLSTATPGATLTIIRLS
13hqvA 0.41 0.29 0.68 4.27Download --SDKGVSAGPGPMGLMGPRG-PGAVGA-GPQGFQGPAGE-GE-GQTGPAGSRGPAG-PGKAGEDGH-GKPGR-GERGVVGPQGARGF-GT-GL-GF-GIRGHNGLDGLKGQ-GAQGV-GE-GA-GENGT-GQAGARGL-GERGRVGA-GPAGARGSDGSVGPVGPAGPIGSAG-PGF---P---GELGPVGN-GPAGPAGPRGEAGL-GLSGPVG-PGNPGANGLTGA-GATGL-GVAGA-GL-GPRGI-GPVGAAGATGPRGLVGE-GPAGS-GETGNKGE-GSAGAQG-PGPSGEEGKRGSPGEPGSAGPAG-PGLRGS-GSRGL-GADGRAGVMGPPGNRGSTGPAGVRGPNGDAGR-GE-GLMGPRGL-GS-GNVGPAGKEGPVGL-GIDGR-GPIGPAGPRGEAGNIGF-GPKGPSGD-GK-GEKGHPGLAGARGA-GPDGNNGAQG-PGPQGVQGGKGEQGPAG-PGFQGL-GPSGTAGEVGK-GERGLPGEFGL-GPAGPRGERG-PGESGAAGPSGPIGIRGPSGA-GPDGNKGEAGAVGAPGSAGASGPGGL-GERGAAGI-GGKGEKGETGLRGEIGNPGRDGARGA-GAIGA-GPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGSAGQ-GA-GEKGTKGPKGENGIVGPTGPVGAAGPSGPNGPPGPAGSRGDGGPPGMTGF-GAAGRTG-PGPSGITGP---PGAAGKEGIRGPRGDQGPVGRTGEIGASGPPGFAGEKGPSGE-GTTG-PGTAGPQGLLGA-GILGL-GSRGERGQ-GIAGALGE-GPLGIAG-PGARG-PGAVGS-GVNGA-GEAGRDGN-GSDG-PGRDGQ-GHKGERGY-GNIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGD-GARGLPGLKGHNGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPIGKDGRSGHPGPVGPAGVRGSQGSQGPAG-PGP---PGPPGVSG--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
27b75A 0.12 0.18 0.74 1.25Download ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PLRPCELQRETAFLKQADYVPQCAEDGSFQTVQCQNDGRSCWCVGANGSE-VLGSR-QPGVACLQCQDSGDYAPVAEGMEVYGTRQLGRPKRCPRLLHGVDKSPPQCSAEGEFMPTTDMMIFDLVHSYNRFPDAFVTFSRFPEDSQGRELAETEIYDTIFAGLDLPSTISGTSFGHPYVPSCRRNGDYQAVQTEGAQGKERQQGEPPSC-AEGQSCASLYFGTSATSCPPTDSGLEGQS-QQFSVGGKGQFNLSGALGTRGTVGSFGFEINSVPECEQTPERLFVPEGSSGSWGKELPGSRRGGQPRCPTDCEKMGSQPAGSTLFVPACTSEGDAEGQAIPGTRSAIGKPKSNSSMLPTLSDTYIPQCSTDGQWRQNGPPENKGIMSYRELQDVPLAALEGKRPQPRENILLEPYLFWQILNGQ--LSQYPGSYSDFSTPLAHFDLRNCWCVDEAG-QELEGMRSEPSKLPTPGSSASNSSRFPLGLPPLFPPQFLRGSFSPDDSAGASALLRSGPYMPQCDAFGSTGHVDEKGGFIPGSLTARSLQIPQCPTRSQENPSPKDLFVPACLETGEYARL----QASGAGTDPASGEELRPGSSSSAQCPSLSRRVSPGYVPACRAEDGGFSPVQCDQAQGSVMDSGEEVPGTR-----VTGGQPAESPRCPLPFNASEVVGGTILCQRQGSWSVFPPGQLPQPRACQRPLQLPPGKMCSADYADLRGTFGTLVSVCNNSSVVDIPVASLPDQSGSQGDHFGTSPRTWFGSEGYQVLTSEASQDGLGCVKCPEGEECIPCPVGFYQEQAGS-LACVPCPVGRTTISAGAFSQTHCVTDCQRNEAGLQCDNGQYRASQKDRGSGGEGRRLPWTEAPLEDSQCLMMQKFEKVPKVIFDANAPVAVRSKVPDSCTEDEACSFFTVSTTEPEISCDFYAWTSDLRCQVKVRSHGQDSPAVYLKKGQTGFQNMLSGLYACDRD-LCCDGFVLTQVQGGA--IICGLLSSPSVLLCNVKDWMDPTCPGVTNFQQVYLWKDSDMGSRPESMGCRKDTVPRP
33hr2 0.41 0.30 0.67 5.06Download VSAGPGPMGLMG---------PRGPG------AV-------------------G-AGPQGFQGPAGEGGPAGSRGPA-GPGKAGEDGH----GKPGR-GERGVVGPQGARGFGT--GLG-------F-GIRGHNGLDGLKGQ-GA---QGV-GE-----GAGENGT-GQAGARGL----GERGRVGA-------------------------GPAGARGSDGSVGPVGPAGPIGSAGP----GFGAG---PGELGPVGN-GPAGPAGPRGEAGL-------GLSGPVG-PGNPGANGLTGAG-ATGL-GVAGA--GL------------GPRGI-GPVGAAGATGPRGLVGEG--PAGSGETGNKGE-GSAGAQG-------------------PGPSGEEGKRGSPGEPGSAGPAGP-GLRGS-GSRGL-GADGRAGVMGPPGNRGSTGPAGVRGPNGDAGR--GEGLMGPRGLSGNVGPAGKEGPVGIDGR-GPIGPAGPRGEAGNIGF----GPKGPSGDG-----KGEKGHPGLAGARG-AGPDGNNGAQG-PGPQGVQGGKGEQGPAGP-GFQGPSGTAGEVGK-------GERGLPGEFGL-GPAGPRGERG-PGESGAAGPS---------------GPIGIRGPSGA-GPDGNKGEAGAVGAPGSAGASGPGG-LGERGAAGI-GGK---GEKGETGLRGEIGNPGRDGARG-AGAIG-------------------AGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGP---------------NGFAGPAGSAGQG--------AGEKGTKGPKGENG---------IVGPTGPVGAAGP------SGPNGPPGPAGSRGDGGPPGMTGF-GAAGRTGPG-PS------GITGPPGAAGKEGIRGPRGDQGPVGRTGEIGASGPPGFAGEKGPSGEGTGPGTAGPQGLLG---A-GILGL-GSRGERG-QGIAGALGE-GPLGIAG-PG------A---RG-PGAVG-SGVNG----AGEAGRDGNPGRDG-QGHKGERGY-GNIGPTGAAGAPGPHGSVGPA---GKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPG----------D------GARGLPGLKGHNGLQGLPGLAGLHGDQG---APGPVGPAGPRGPAGPSGPI------GKDGRSGHPGPVGPAGVRGSQGSQGPAGPGPGP------GPPGVSGGG------------------------------------------------------------------------------------------------------------------------------------------------
46wku 0.17 0.08 0.11 5.29Download ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TRGFVFTRHSQTTAIPSCPEGTV--------PLYSGFSFLFVQGNQRA---HGQDLGLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNSRCTVCEGPAIAIAVHSQTTIPPCPHGWISLWKGFSFIMFTGQALASPGSCLEEFRA-
53hr2 0.39 0.30 0.68 3.47Download -----SDKGVSAGPGPMGLMGPRGPAGPQGFQGPAGEG--EGQ---TGPAGSRGPA-GPGKAGEDG------------H-GKPGR-GERGVVGPQGARGFGT--GLFGIRGHNGLDGLKGQ-GAQGV-GE--------GAGENGT-GQAGARGL-------GERGRVGA-GPAGARGSDGSVGPVGPAGPIGSAGP-GFGAGPGELGPVGN----GPAGPAGPRGEAGL-GLSGPVG----------PGNPGANGLTGAG-ATGL-G---V---AGA--GLG---PRGI-GPVGAAGATGPRGLVGEG-----PAGSGET------------------------GNKGE-GSAGAQG-PGPSGEEGKRGSPGEPGSAGPAGP-------GLRGS-GSRGL-GADGRAGVMGPPGNRGSTGPAGVRGPNGDAGR--GEGLMGPRGLG--SGNVGPAGKEGPVGL-GIDGR-GPIGPAGPRGEAGNIGF-GPKGPSGDG--------KGEKGHPGLAGAR------------G-A---------GPDGNNGAQG-PGPQGVQGGKGEQGPAGP-GFQGL-GPSGTAGEVGK----GERGLPG------------------EFGL----GPAGPRGERG-PGESGAAGPSGPIGIRGPSG---A-GPDGNKGEAGAVGAPGSAGASGPGG-LGE---------RGAAGI-G------------------GKGEKGETGLRGEIGNPGRDGAR---G----AGAIG-AGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEV---GPAGPNGFAGPAGSAGQG-----AGEKGTKG---------PKGENGIVGPTGPVGAAGPSGPNGPPGPAGSRGDGGPPGMTGF-GA---AGRTGPG-PSGITGPG--PGAAGKEGIRGPRGDQGPVGRTGE---------------------IGASGPPGFAGEKGPSGEG-----T---TGPGTAGPQGLLGA-GILGL-GSRGERG-QGIAGALGE-GPLGIAG-------PGARG-PGAVG-SGVNG-AGEAGRDGN-GSDG-PGRDG-QGHKGERGY-GNIGPTGAAGAPGPHGSVGPAGKHGNRGEPGP---AGSVGPV---GAVGP---RGPSGPQGIRGDKGEPG-DGARGLPGLKGHNGLQGLPGLAGLHG---DQGAPGPV------GP---AGPRGPAGPSGPIGKDGRSGHPGPVGPAGVRGSQGSQGPAGPGPGPGPPGVSGGG------------------------------------------------------------------------------------------------------------------------------------
62pffB 0.32 0.30 0.9112.20Download ----KWETTTQFKATHILDFGP-GGASGLGVLTHRNKDGTGVRVIVAGTLDINPDDDYGFKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGQGSQEQGGEKGFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-----------------------------------------------------------------------------------------------------------------------------
71li1A 0.09 0.03 0.11 1.79Download -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM--PFLFCINNVCNFASRNDYSYWLSTPEPMPMSMFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAP
87b75A 0.08 0.11 0.65 3.37Download PLRRETAFLKQADYVPQEDGSFQTVQCQNDGVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSYLPQCQDSGDYAPVDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSPPQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFPEVSADSQGRELAETGLELLLDEIYDTIFAGLDLPSTFTETISGRFRCPTKCEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTRQQGEPPSCAEGQSCASEYFGTSATSCPPTIKELFVDSGLLRPMVEGQSQQFSVSENLFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNVGQFNLSGALGTRGTFNPTVGSFGFEINLQENQNALKFLASLLELPEFLLFLQHAISVPEDVA--------------------------------------------------------------------------------------------------------------------------RDLGDVMETVLSSQTCEQTPERLFVPSCTTEGSYEDVQCFSGECWCVNSWGKELPGSRVRGGQPRCPTDCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEGQAIPGTRSAIGKPKKCPTP-------------------CQLQSEQAFLRTVQALLSNSSMLPTLSDTYIPQCSTD-GQWRQVQCNGPPKGQDLTPAKLLVKIMSYRELQDVPLAALEGKRPQPREN----------------------------------------------------------ILLEPYLFWQILNGQLSQYPGSYSDFSTPLAHFDLRNCWCVDEAGQELEGMRSEPSKLPTCPGSCEESASNSSRFPLGESFLVAKGIRLRNEDLGLPPLFPPFLRGSDYAIRLAAQSTLSFYQRRRFSPDDSAGASALLRSGPYMPQCDAFGSWEPVQCHAGTGVDEKGGFI--------PGSLTARSLQIPQCPTTCEKSRTSGLLSSWKQARSQENPSPKD--------------------------------------------------------------------------------------------------------------------------------LFVPACLETGEYARLQASGAGDPASGEELRPGSS-----------------------------------------------------------------------------------------------------------------------------------------------------S
91li1A 0.15 0.03 0.11 1.47Download -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VDHGSQTIDDPQCPSGTKILHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPLFCNINNVCNFASRNDYSYWLSTPEPMPMSAPITGENIRPFISRCAVCEAPAMVMAVHSQTIIPPCPSGWSSLWIGYSFVMHTSAGLASPGSCLEEFRSA
103hqvA 0.25 0.29 0.67 7.11Download -QMSYGYDEKSAGVSVPGPMGPSGPRGLGPGAGPQGFQGPGEGEGGSGPMGPPGPGP--GKNGDDGEAGKPGRGE--RGPGPQGARGLGTAGLGMGHRGFSGLDGAKGDTGPAGPKGEGSGENGTGQMGPRGLGERGRGPGTAGARGNDGAVGAAGPGPTGPTGPGFGAAGAKGEAGPQGARGSEGPQGVRGEGPGPAGAA-GPAGNGADGQGAKGANGAGIAGAGFGARGPSGPQGPSGAGPKGTSGEGAGNKGDTGAKGEGPAVQGPGPAGEEGKRGARGEGPSGLGPGERGGGSRGFGADGVAGPKGPSGERGSGPAGPKGSGEAGRGEAGLGAKGLTGSGSGPDGKTGPGPAGQDGRGPAGPGARGQAGVMGFGPKGTAGEGKAGERGVGPGAVGPAGKDGEAGAQG-AGPAGPAGERGEQGPAGSGFQGLGPAGPGEAGKGEQGVGDLGAGPSGARGERGFGERGVQGPGPAGPRGNNGAGNDGAKGDTGAGAGSQGAGLQGMGEGAAGLGPKGDRGDAGPKGADGSPGKDGVRGLTGPIG--PGPAGAGDKGEAGPSGPAGPTGARGAGDRGEAGP--GPAGFAGPGADGQGAKGEGDTGVKGDAG-PGPAGPAGPGPIGNVGAGPGSRGAAGPGATGFGAAGRV--GPGPSGNAGPGPGPVGKEGGKGPRGETGPAGRGEVGPGPGPAGEKGSGADGPAGSGTPGPQGIAGQRGVVGLGQRGKRGFGLGPSGEGKQGPSGASGERGPGPMGPGLAGPGESGREGSGAEGSGRDGAGAKGDRGETGPAGPGAGAGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDGETEQGDRGIGHRGFSGLQGPGSGSGEQGPSGASGPAGPRGPGS--AGSGKDGLNGLGPIGGPRGRTGDSGPAGPGPGPGPGPPSGGYDFSFLPQPPQEKSQDGGRY-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
(a)All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)
(b)Rank of templates represents the top ten threading templates used by I-TASSER.
(c)Ident1 is the percentage sequence identity of the templates in the threading aligned region with the query sequence.
(d)Ident2 is the percentage sequence identity of the whole template chains with query sequence.
(e)Cov represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein.
(f)Norm. Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa.
(g)Download Align. provides the 3D structure of the aligned regions of the threading templates.
(h)The top 10 alignments reported above (in order of their ranking) are from the following threading programs:
       1: FFAS-3D   2: SPARKS-X   3: HHSEARCH2   4: HHSEARCH   5: HHSEARCH I   6: Neff-PPAS   7: PRC   8: PROSPECT2   9: SP3   10: FFAS03   

   Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of a higher value signifies a model with a higher confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated; this is usually an indication that the models have a good quality because of the converged simulations.)
    (By right-click on the images, you can export image file or change the configurations, e.g. modifying the background color or stopping the spin of your models)
  • Download Model 1
  • C-score=-1.87 (Read more about C-score)
  • Estimated TM-score = 0.49±0.15
  • Estimated RMSD = 14.5±3.7Å

  • Download Model 2
  • C-score = -2.00

  • Download Model 3
  • C-score = -2.15

  • Download Model 4
  • C-score = -2.11

  • Download Model 5
  • C-score = -3.12



  Predicted function using COFACTOR and COACH

(This section reports biological annotations of the target protein by COFACTOR and COACH based on the I-TASSER structure prediction. While COFACTOR deduces protein functions (ligand-binding sites, EC and GO) using structure comparison and protein-protein networks, COACH is a meta-server approach that combines multiple function annotation results (on ligand-binding sites) from the COFACTOR, TM-SITE and S-SITE programs.)

  Ligand binding sites

No binding site was predicted by COACH.

[Click on S686517_results.tar.bz2 to download the tarball file including all modeling results listed on this page]



Please cite the following articles when you use the I-TASSER server:
  • Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. Cell Reports Methods, 1: 100014 (2021).
  • Chengxin Zhang, Peter L. Freddolino, and Yang Zhang. COFACTOR: improved protein function prediction by combining structure, sequence and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017).
  • Jianyi Yang, Yang Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.