[Home] [Server] [Queue] [About] [Remove] [Statistics]

I-TASSER results for job id S692866

(Click on S692866_results.tar.bz2 to download the tarball file including all modeling results listed on this page. Click on Annotation of I-TASSER Output to read the instructions for how to interpret the results on this page. Model results are kept on the server for 60 days, there is no way to retrieve the modeling data older than 2 months)

  Submitted Sequence in FASTA format


  Predicted Secondary Structure

Sequence                  20
H:Helix; S:Strand; C:Coil

  Predicted Solvent Accessibility

Sequence                  20
Values range from 0 (buried residue) to 9 (highly exposed residue)

   Predicted normalized B-factor

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. Click here to read more about predicted normalized B-factor)

  Top 10 threading templates used by I-TASSER

(I-TASSER modeling starts from the structure templates identified by LOMETS from the PDB library. LOMETS is a meta-server threading approach containing multiple threading programs, where each threading program can generate tens of thousands of template alignments. I-TASSER only uses the templates of the highest significance in the threading alignments, the significance of which are measured by the Z-score, i.e. the difference between the raw and average scores in the unit of standard deviation. The templates in this section are the 10 best templates selected from the LOMETS threading programs. Usually, one template of the highest Z-score is selected from each threading program, where the threading programs are sorted by the average performance in the large-scale benchmark test experiments.)

Rank PDB
15xeiA 0.50 0.34 0.69 1.17Download KRAEIEENTIKVKSAQLRIQLE----------
35eqjA 0.10 0.31 0.91 1.05Download -PRA--LKGGKKNSYYRKLRWYNTQWQILELT
47apkG 0.20 0.25 0.94 1.01Download --KELEALGKELEHLSHIKESVEDKLELRRKQ
51hywA 0.21 0.25 0.88 1.01Download --RRVEFTATSVSDLKKYIAELEVQTGMTQ--
65g2fA 0.23 0.25 0.69 0.30Download ----------NLAAGQSYVRNVALALEAQRDP
93v3k 0.45 0.25 0.34 0.87Download ----SELNHNHFLSP-----------------
103izcA 0.23 0.25 0.97 0.97Download KRTKIKVNYNHLLPTRYTLDVEAFKSVVST-E
(a)All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)
(b)Rank of templates represents the top ten threading templates used by I-TASSER.
(c)Ident1 is the percentage sequence identity of the templates in the threading aligned region with the query sequence.
(d)Ident2 is the percentage sequence identity of the whole template chains with query sequence.
(e)Cov represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein.
(f)Norm. Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa.
(g)Download Align. provides the 3D structure of the aligned regions of the threading templates.
(h)The top 10 alignments reported above (in order of their ranking) are from the following threading programs:
       1: HHSEARCH   2: Neff-PPAS   3: Neff-PPAS   4: Neff-PPAS   5: Neff-PPAS   6: FFAS-3D   7: SPARKS-X   8: SP3   9: HHSEARCH   10: wdPPAS   

   Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of a higher value signifies a model with a higher confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated; this is usually an indication that the models have a good quality because of the converged simulations.)
    (By right-click on the images, you can export image file or change the configurations, e.g. modifying the background color or stopping the spin of your models)
  • Download Model 1
  • C-score=-1.94 (Read more about C-score)
  • Estimated TM-score = 0.48±0.15
  • Estimated RMSD = 5.6±3.5Å

  • Download Model 2
  • C-score = -1.89

  • Download Model 3
  • C-score = -1.83

  • Download Model 4
  • C-score = -5

  • Download Model 5
  • C-score = -1.75

  Proteins structurally close to the target in the PDB (as identified by TM-align)

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

to view
RankPDB HitTM-scoreRMSDaIDENaCovAlignment
16sd8X0.613 2.470.0941.000Download
23djlA10.611 2.570.0941.000Download
33tq6A0.610 2.100.0650.969Download
42aw3A20.603 2.310.0941.000Download
57wnnB0.598 2.640.0631.000Download
64i83A0.596 2.140.0340.875Download
76bqnC0.595 2.420.0310.969Download
83rfrC0.595 2.550.1000.938Download
95e04A0.595 2.580.0940.969Download
102r31A0.594 2.670.0311.000Download

(a)Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

  Predicted function using COFACTOR and COACH

(This section reports biological annotations of the target protein by COFACTOR and COACH based on the I-TASSER structure prediction. While COFACTOR deduces protein functions (ligand-binding sites, EC and GO) using structure comparison and protein-protein networks, COACH is a meta-server approach that combines multiple function annotation results (on ligand-binding sites) from the COFACTOR, TM-SITE and S-SITE programs.)

  Ligand binding sites

to view
Ligand Binding Site Residues
10.21 212 2xqcD Nuc.Acid Rep, Mult 21,22,25,26
20.19 190 2aznD MA5 Rep, Mult 18,19,22,23
30.13 136 4wgfB HX2 Rep, Mult 17,18,20,21
40.09 82 1savA CA Rep, Mult 24,25,27
50.01 12 5fjyB PEPTIDE Rep, Mult 27,30,31

Download the residue-specific ligand binding probability, which is estimated by SVM.
Download the all possible binding ligands and detailed prediction summary.
Download the templates clustering results.
(a)C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)Cluster size is the total number of templates in a cluster.
(c)Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column.
Mult is the complex structures with all potential binding ligands in the cluster.

  Enzyme Commission (EC) numbers and active sites

to view
TM-scoreRMSDaIDENaCovEC NumberActive Site Residues
10.1703gehA0.590 2.520.0970.969 3.6.-.-  NA
20.1623ipiA0.569 2.330.0650.938 2.5.1.-  NA
30.1601gd9A0.572 2.190.0320.938 2.6.1.-  NA
40.1533e6iA0.570 2.780.1250.938 1.14.13.-  NA
50.1453tatC0.525 2.450.0630.812  NA

 Click on the radio buttons to visualize predicted active site residues.
(a)CscoreEC is the confidence score for the EC number prediction. CscoreEC values range in between [0-1];
where a higher score indicates a more reliable EC number prediction.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided
by length of the query protein.

  Gene Ontology (GO) terms
Top 10 homologous GO templates in PDB 
RankCscoreGOTM-scoreRMSDaIDENaCovPDB HitAssociated GO Terms
1 0.170.5899 2.52 0.10 0.973gehA GO:0016787 GO:0005737 GO:0005525 GO:0046872 GO:0008033 GO:0000166 GO:0003924 GO:0005622 GO:0006184 GO:0006400 GO:0007264
2 0.170.5864 2.05 0.07 0.942jafA GO:0016020 GO:0018298 GO:0016021 GO:0007602 GO:0004872 GO:0006811 GO:0050896 GO:0005886 GO:0009881 GO:0006810 GO:0005216
3 0.160.5915 2.31 0.07 0.941vjhA GO:0006952 GO:0009607
4 0.160.5843 2.55 0.09 0.973hwcA GO:0004497 GO:0003995 GO:0008152 GO:0055114 GO:0016712 GO:0010124 GO:0016627
5 0.160.5754 2.46 0.13 0.912j8dM GO:0018298 GO:0022900 GO:0015979 GO:0006810 GO:0042314 GO:0016020 GO:0046872 GO:0016021 GO:0042717 GO:0016168 GO:0009772 GO:0019684 GO:0030077 GO:0045156
6 0.160.5886 2.54 0.07 0.942xzmO GO:0003735 GO:0005840 GO:0006412 GO:0005622
7 0.150.5896 2.39 0.03 1.002dg7A GO:0006351 GO:0006355 GO:0003677 GO:0005515
8 0.150.5845 2.48 0.14 0.912p5tE GO:0043565 GO:0003677 GO:0006351 GO:0006355
9 0.150.5811 2.45 0.00 0.911vd5A GO:0005975 GO:0008152 GO:0016798 GO:0000272 GO:0005737 GO:0016787 GO:0003824
10 0.150.5783 2.55 0.06 1.002gauA GO:0006351 GO:0003677 GO:0006355

Consensus prediction of GO terms
Molecular Function GO:0038023 GO:0016462 GO:0015075 GO:0032561 GO:0035639 GO:0022838 GO:0016168 GO:0046872
GO-Score 0.34 0.34 0.34 0.34 0.34 0.34 0.32 0.30
Biological Process GO:0009583 GO:0023052 GO:0009207 GO:0034470 GO:0006399 GO:0007154 GO:0050794 GO:0046039 GO:0042178 GO:0019439
GO-Score 0.34 0.34 0.34 0.34 0.34 0.34 0.34 0.34 0.32 0.32
Cellular Component GO:0071944 GO:0030076 GO:0042716 GO:0034357 GO:0044433 GO:0016021
GO-Score 0.34 0.32 0.32 0.32 0.32 0.30

(a)CscoreGO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on CscoreGO of the template.

[Click on S692866_results.tar.bz2 to download the tarball file including all modeling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
  • Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. Cell Reports Methods, 1: 100014 (2021).
  • Chengxin Zhang, Peter L. Freddolino, and Yang Zhang. COFACTOR: improved protein function prediction by combining structure, sequence and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017).
  • Jianyi Yang, Yang Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.