[Home] [Server] [Queue] [About] [Remove] [Statistics]

I-TASSER results for job id S693418

(Click on S693418_results.tar.bz2 to download the tarball file including all modeling results listed on this page. Click on Annotation of I-TASSER Output to read the instructions for how to interpret the results on this page. Model results are kept on the server for 60 days, there is no way to retrieve the modeling data older than 2 months)

  Submitted Sequence in FASTA format

>protein
MHHHHHHSSGVDLGTKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEE
KFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
YPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADG
GYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMT
INGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLL
TDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRT
AVINAASGRQTVDEALKDAQTDYDIPGTENLYFQSNAMLSAIGIVPSAPVLVPELAGPAA
AELADLGAAVIAAASLLPKSWIAVGTGRADDVVRPTDVGTFAGFGADVRVGLAPQDGDGV
AVPVELPLCALLTAWVRGQARPEARAQVHVYASDHGSDAAVARGRQLRADIDREPDPIGV
LVVADGLNTLTPRAPGGYDPDGAGMQRALDDALASGDLAVLTRLPAQVLGRVAFQVLAGL
AEPGPRSAKEFYRGAPHGVGYFAGVWQP

  Predicted Secondary Structure

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440                 460                 480                 500                 520                 540                 560                 580                 600                 620
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |        
MHHHHHHSSGVDLGTKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTDYDIPGTENLYFQSNAMLSAIGIVPSAPVLVPELAGPAAAELADLGAAVIAAASLLPKSWIAVGTGRADDVVRPTDVGTFAGFGADVRVGLAPQDGDGVAVPVELPLCALLTAWVRGQARPEARAQVHVYASDHGSDAAVARGRQLRADIDREPDPIGVLVVADGLNTLTPRAPGGYDPDGAGMQRALDDALASGDLAVLTRLPAQVLGRVAFQVLAGLAEPGPRSAKEFYRGAPHGVGYFAGVWQP
PredictionCCCCCCCCCCCCCCCCCCCCSSSSSSCCCCHHHHHHHHHHHHCCCCCCSSSSSSCCCHHHHHHHHHHCCCCCSSSSSCCHHHHHHHHCCCSSCCCCCCCHHHHCCHHHHHHCSSCCSSSSSSCCCCSSSSSSSCHHCCCCCCCHHHHHHHHHHHHCCCCCSSSSSCCCHHHHHHHHHHCCCSSSSCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCSSSSSSCHHHHHHHHHCCCCSSSSSCCCCCCCCCCCSSSSSSSSSSCCCCCHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCHHHHHHHHHHHCHHHHHHHHHHHCCSSCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHCCCCSSSSCCCCCCCCCCCCCCCCCCCCCCCCSSSCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCSSSSSCCCCCHHHHHHHHHHHHHHCCCCCCCSSSSSSSCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCSSSSSCCCCCCCCSSSSSSCC
Conf.Score9988888778887678898579999558835899999999962677966999857669999999975799984999895679999988883469966101532688878631999999998232543499998022168999999999999997427975599835778999999997489054647996333420138999999999999999708989889814788898759978999483257888654897699966899999887546515999989999999999999998569999999998189886605541034442932999999984177578788789999999999999984999999999999999977534232334554566534577864201544166631278999999999985788479983587777779999888666787743446888877788988886889999999730567786168874799998999999999875314677865899970553447899999989540457899999985658998845880012608999987513379971147745899867657777249
H:Helix; S:Strand; C:Coil

  Predicted Solvent Accessibility

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440                 460                 480                 500                 520                 540                 560                 580                 600                 620
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |        
MHHHHHHSSGVDLGTKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTDYDIPGTENLYFQSNAMLSAIGIVPSAPVLVPELAGPAAAELADLGAAVIAAASLLPKSWIAVGTGRADDVVRPTDVGTFAGFGADVRVGLAPQDGDGVAVPVELPLCALLTAWVRGQARPEARAQVHVYASDHGSDAAVARGRQLRADIDREPDPIGVLVVADGLNTLTPRAPGGYDPDGAGMQRALDDALASGDLAVLTRLPAQVLGRVAFQVLAGLAEPGPRSAKEFYRGAPHGVGYFAGVWQP
Prediction6435656444555545546030000012663150034006402762704032231740241033004332000000000100020013100130446443364014001400304200000000000000000131164024004202400440256431000000300000000000000100245444332431102273013004101400644302442436303400441200000000100430453713000000002744421000000000002406125001300330023640032025623201233423454146132030014005203110212303300410240033014353304400540163035314633323340200000000100010031034324304400300130031014100000003233313262100000010203010234435444432200000000000012031303030100147231630241044014314634210000000000111034011121430440242023002300140024023400100000000000232313031102100000000003037
Values range from 0 (buried residue) to 9 (highly exposed residue)

   Predicted normalized B-factor

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. Click here to read more about predicted normalized B-factor)


  Top 10 threading templates used by I-TASSER

(I-TASSER modeling starts from the structure templates identified by LOMETS from the PDB library. LOMETS is a meta-server threading approach containing multiple threading programs, where each threading program can generate tens of thousands of template alignments. I-TASSER only uses the templates of the highest significance in the threading alignments, the significance of which are measured by the Z-score, i.e. the difference between the raw and average scores in the unit of standard deviation. The templates in this section are the 10 best templates selected from the LOMETS threading programs. Usually, one template of the highest Z-score is selected from each threading program, where the threading programs are sorted by the average performance in the large-scale benchmark test experiments.)

Rank PDB
Hit
Iden1Iden2CovNorm.
Z-score
Download
Align.
                   20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440                 460                 480                 500                 520                 540                 560                 580                 600                 620
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |        
Sec.Str
Seq
CCCCCCCCCCCCCCCCCCCCSSSSSSCCCCHHHHHHHHHHHHCCCCCCSSSSSSCCCHHHHHHHHHHCCCCCSSSSSCCHHHHHHHHCCCSSCCCCCCCHHHHCCHHHHHHCSSCCSSSSSSCCCCSSSSSSSCHHCCCCCCCHHHHHHHHHHHHCCCCCSSSSSCCCHHHHHHHHHHCCCSSSSCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCSSSSSSCHHHHHHHHHCCCCSSSSSCCCCCCCCCCCSSSSSSSSSSCCCCCHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCHHHHHHHHHHHCHHHHHHHHHHHCCSSCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHCCCCSSSSCCCCCCCCCCCCCCCCCCCCCCCCSSSCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCSSSSSCCCCCHHHHHHHHHHHHHHCCCCCCCSSSSSSSCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCSSSSSCCCCCCCCSSSSSSCC
MHHHHHHSSGVDLGTKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTDYDIPGTENLYFQSNAMLSAIGIVPSAPVLVPELAGPAAAELADLGAAVIAAASLLPKSWIAVGTGRADDVVRPTDVGTFAGFGADVRVGLAPQDGDGVAVPVELPLCALLTAWVRGQARPEARAQVHVYASDHGSDAAVARGRQLRADIDREPDPIGVLVVADGLNTLTPRAPGGYDPDGAGMQRALDDALASGDLAVLTRLPAQVLGRVAFQVLAGLAEPGPRSAKEFYRGAPHGVGYFAGVWQP
13f5fA 0.72 0.67 0.86 3.97Download ---------------KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAADEEDDVV----IIYNRVPKTASTSFIAYDLCAKSLQDQVRFVKNVTSWKEMKP--GFYHG---------HVSYLDFAKFGVPIYINV-----------IRDPIERLVSYYYFLRFGDDYRPGLRRRGDKKTFDECVA---------AGGSDLQIPFFCGHSSECWNVGS-----------RWALEQA-----KYNLIN-EYFLVGEDFIMLLEAAL-------PRFFRGA-------------
27kd5A 0.86 0.60 0.68 2.38Download ----------------IEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAKSSA---------------------------ASPAALSGYKMTLLALIKESIPNQ-----------------------------------------------AKRQKFEMQVGGIRNE------------------QDFKNLRREIIRSAA--------------------------------------------------------------------------------------------
34hs7 0.28 0.19 0.59 1.09Download ---------------KDKPNQLTMWVDGDKQMAFYKKITDQYTKKTGIKVKLVNINDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEIKLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKLTDSKKYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQKWYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETGKDLGVTTLPTDGGKPMKPFLGVRGWYLSEYSKHKYWAKDLML-YITSKDTLQKYTDEMS-EITGRVDVK---SSNPNLKVFEKQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNP-KQALDEATNDITQNIKILHP--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
44hs7 0.28 0.19 0.59 0.81Download ---------------KDKPNQLTMWVDGDKQMAFYKKITDQYTKKTGIKVKLVGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEIKLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKLTDSKKYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQKWYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETGKDLGVTTLPTDGGKPMKPFLGVRGWYLSEYSKHKYWAKDLML-YITSKDTLQKYTDEMSEITGRVDVK----SSNPNLKVFEKQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNP-KQALDEATNDITQNIKILHP--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
57p0fA 0.70 0.65 0.87 3.11Download --------------AKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAEFTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGC--------------------------------FWPNAEVDRFFLAVHGRYFRSCPIQ-----LGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCQRTWDGWLCWNDVAAGDYFQDFDPSEKVTKICDQDG---------------------NWFRHPASQRTWTNYTQCN------------
63dm0 0.90 0.66 0.63 1.27Download ----------------IEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPGAVALKSY-EEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAGLVLKGTMRHTDMVTAIATPIDNDIIV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
74pe2A 0.80 0.64 0.76 9.17Download ----------------IEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAASN--------------------------INKAKVASVESDYSSVKSAALSYYSDKNTMPPSGELDALETYMDLPDKADIGGGLKIG-----DGTAADSVTLT-KAQIEKLLSDIGPKK------IYTENT-----------LKTELQKKDGTLYIVLIDN-----------------------------------------------------------------------------------
85azaA 0.93 0.60 0.64 2.16Download ---------------KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRIAAA-------------------------KAEAA----AKAEAAAKAAAAWEDALK--WLRENT--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
97p0fA 0.71 0.65 0.87 3.87Download -------------SAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAEFTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMA------------------------------------EKLGCFWPNAEVDRFFLAVHGRYFRSCPIQLGVTRNKI-MTAQYECYQKIMQDPIQQAEGVYCQRTWDGWLCWNDVAAGTESMQLCP----------------------------------DYFQDFDPSEKVTKICDQDGNWFRHPASQR
106vlsA 0.66 0.70 0.98 4.63Download ---------------KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTAARAFAAASGSMVGNNLFGRSALKTASELITKENVKTSGSEVGNVYNFLIVLTALQAKAFLTLGLADIDVNILPTLSNTFSGSDEDAKMIVEAKPGHAEISNDSITVLKVYEAKLKQNYQVDKDSLSEVIYGDMDKLLCPDQSEQIKIDFTKKMKTLRYEVTANGERTLSANDDGVYDENSRLITLTLRELLLATDLTKLIVPPSGFISNIVGSIEEDNLEPWKANNKNAYVDHTGGVNGTKALYVG
(a)All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)
(b)Rank of templates represents the top ten threading templates used by I-TASSER.
(c)Ident1 is the percentage sequence identity of the templates in the threading aligned region with the query sequence.
(d)Ident2 is the percentage sequence identity of the whole template chains with query sequence.
(e)Cov represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein.
(f)Norm. Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa.
(g)Download Align. provides the 3D structure of the aligned regions of the threading templates.
(h)The top 10 alignments reported above (in order of their ranking) are from the following threading programs:
       1: FFAS-3D   2: SPARKS-X   3: HHSEARCH2   4: HHSEARCH I   5: Neff-PPAS   6: HHSEARCH   7: pGenTHREADER   8: wdPPAS   9: PROSPECT2   10: SP3   

   Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of a higher value signifies a model with a higher confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated; this is usually an indication that the models have a good quality because of the converged simulations.)
    (By right-click on the images, you can export image file or change the configurations, e.g. modifying the background color or stopping the spin of your models)
  • Download Model 1
  • C-score=-1.58 (Read more about C-score)
  • Estimated TM-score = 0.52±0.15
  • Estimated RMSD = 11.6±4.5Å

  • Download Model 2
  • C-score = -1.51

  • Download Model 3
  • C-score = -2.11

  • Download Model 4
  • C-score = -3.40

  • Download Model 5
  • C-score = -3.04


  Proteins structurally close to the target in the PDB (as identified by TM-align)

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)


Top 10 Identified stuctural analogs in PDB

Click
to view
RankPDB HitTM-scoreRMSDaIDENaCovAlignment
13f5fA0.859 2.370.6770.898Download
27b01A0.691 3.890.6930.767Download
33dm0A0.674 3.910.6060.750Download
45eduB0.664 3.960.7200.740Download
54h1gA0.647 4.580.6740.728Download
65t03A0.641 3.880.7130.704Download
73mp8A0.639 2.830.7720.677Download
83h4zA0.634 3.280.7690.681Download
94bl8A0.634 3.830.7140.691Download
107p0fA0.625 2.980.7790.661Download

(a)Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.


  Predicted function using COFACTOR and COACH

(This section reports biological annotations of the target protein by COFACTOR and COACH based on the I-TASSER structure prediction. While COFACTOR deduces protein functions (ligand-binding sites, EC and GO) using structure comparison and protein-protein networks, COACH is a meta-server approach that combines multiple function annotation results (on ligand-binding sites) from the COFACTOR, TM-SITE and S-SITE programs.)

  Ligand binding sites


Click
to view
RankC-scoreCluster
size
PDB
Hit
Lig
Name
Download
Complex
Ligand Binding Site Residues
10.68 174 3vd8A MTT Rep, Mult 29,30,57,59,60,77,78,80,81,126,168,169,170,171,245,355,356,359
20.14 32 4xzsA GLC Rep, Mult 77,78,80,81,168,169,170,355,359
30.12 32 3h4zA GLC Rep, Mult 27,29,30,78,126,168,170,245
40.01 2 4fedB ZN Rep, Mult 173,343
50.01 3 3iovB CA Rep, Mult 311,312


Download the residue-specific ligand binding probability, which is estimated by SVM.
Download the all possible binding ligands and detailed prediction summary.
Download the templates clustering results.
(a)C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)Cluster size is the total number of templates in a cluster.
(c)Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column.
Mult is the complex structures with all potential binding ligands in the cluster.

  Enzyme Commission (EC) numbers and active sites


Click
to view
RankCscoreECPDB
Hit
TM-scoreRMSDaIDENaCovEC NumberActive Site Residues
10.1432thiA0.454 3.770.1210.527 2.5.1.2  NA
20.1232ow6A0.332 8.590.0280.580 3.2.1.114  NA
30.1053l4uA0.320 7.790.0440.510 3.2.1.20 3.2.1.3  NA
40.1053kx2B0.335 7.680.0700.529 3.6.4.13  79,242
50.1041wdlA0.313 7.820.0490.505 5.3.3.8 5.1.2.3 4.2.1.17 1.1.1.35  NA

 Click on the radio buttons to visualize predicted active site residues.
(a)CscoreEC is the confidence score for the EC number prediction. CscoreEC values range in between [0-1];
where a higher score indicates a more reliable EC number prediction.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided
by length of the query protein.

  Gene Ontology (GO) terms
Top 10 homologous GO templates in PDB 
RankCscoreGOTM-scoreRMSDaIDENaCovPDB HitAssociated GO Terms
1 0.480.6387 2.83 0.77 0.683mp8A GO:0015423 GO:0043190 GO:0006810 GO:0015768 GO:0008643 GO:0042956 GO:0015609 GO:0042597 GO:0005215 GO:0005363 GO:0003677 GO:0006351 GO:0006355 GO:0005737 GO:0009405 GO:0003700 GO:0005515 GO:0005634 GO:0043565 GO:0004930 GO:0004991 GO:0007186 GO:0016020 GO:0005179 GO:0005576 GO:0004872 GO:0016021 GO:0051622 GO:0050806 GO:0005504 GO:0035067 GO:0040012 GO:0042417 GO:0033138 GO:0008198 GO:0010040 GO:0001963 GO:0042493 GO:0050544 GO:0045202 GO:0034341 GO:0034599 GO:0042775 GO:0031623 GO:0010642 GO:0008344 GO:0048488 GO:0071902 GO:0031092 GO:0006644 GO:0050812 GO:0014048 GO:0030054 GO:0042416 GO:0010517 GO:0048169 GO:0006919 GO:0008219 GO:0055074 GO:0006916 GO:0008270 GO:0051612 GO:0006638 GO:0060079 GO:0032410 GO:0060732 GO:0048168 GO:0001956 GO:0043154 GO:0045807 GO:0031115 GO:0030544 GO:0043030 GO:0005739 GO:0019717 GO:0014059 GO:0001774 GO:0005886 GO:0030424 GO:0019894 GO:0001921 GO:0032769 GO:0005509 GO:0006631 GO:0048489 GO:0005829 GO:0015629 GO:0070495 GO:0051281 GO:0051219 GO:0005938 GO:0043014 GO:0060961 GO:0043027 GO:0005856 GO:0043205 GO:0007006 GO:0060291 GO:0030426 GO:0016044 GO:0051585 GO:0070555 GO:0042802 GO:0043524 GO:0046928 GO:0045920 GO:0032026 GO:0042393 GO:0048156 GO:0032496 GO:0000287 GO:0045502
2 0.240.8587 2.37 0.68 0.903f5fA GO:0015609 GO:0015768 GO:0015423 GO:0042956 GO:0006810 GO:0042597 GO:0008643 GO:0043190 GO:0005215 GO:0005363 GO:0008146 GO:0016021
3 0.200.6343 3.28 0.77 0.683h4zA GO:0042597 GO:0005515 GO:0006810 GO:0015609 GO:0043190 GO:0000166 GO:0015423 GO:0006281 GO:0032136 GO:0016887 GO:0005524 GO:0008643 GO:0006974 GO:0006200 GO:0003677 GO:0015768 GO:0003684 GO:0030983 GO:0006298 GO:0042956 GO:0006310 GO:0008094 GO:0005215 GO:0005363
4 0.190.6744 3.91 0.61 0.753dm0A GO:0009845 GO:0005829 GO:0006417 GO:0022626 GO:0004871 GO:0015423 GO:0043190 GO:0006810 GO:0042597 GO:0008643 GO:0042956 GO:0015609 GO:0015768 GO:0007165 GO:0005634 GO:0042254 GO:0009507 GO:0046686 GO:0071215 GO:0005515 GO:0005215 GO:0005363
5 0.190.6170 3.09 0.81 0.663o3uN GO:0008643 GO:0006810 GO:0042597 GO:0005215 GO:0005363 GO:0015768 GO:0015423 GO:0043190 GO:0042956 GO:0015609 GO:0005515
6 0.170.5868 1.74 0.94 0.601a7lA GO:0042597 GO:0008643 GO:0006810 GO:0005215 GO:0005363 GO:0015768 GO:0015423 GO:0043190 GO:0042956 GO:0015609
7 0.170.5623 1.89 0.33 0.582fncA GO:0004175 GO:0005215 GO:0005363 GO:0006511 GO:0006810 GO:0015768 GO:0019773
8 0.170.5632 1.87 0.34 0.582ghaA GO:0004175 GO:0005215 GO:0005363 GO:0006511 GO:0006810 GO:0015768 GO:0019773
9 0.160.5451 2.59 0.23 0.591eu8A GO:0005215 GO:0006810
10 0.160.5501 2.29 0.29 0.582gh9A GO:0005215 GO:0005363 GO:0006810 GO:0015768


Consensus prediction of GO terms
 
Molecular Function GO:0015609 GO:0015423 GO:0016782 GO:0005509 GO:0043014 GO:0003700 GO:0043565 GO:0048156 GO:0030544 GO:0008270
GO-Score 0.80 0.80 0.48 0.48 0.48 0.48 0.48 0.48 0.48 0.48
Biological Process GO:0015768 GO:0042956 GO:0042493 GO:0010517 GO:0014059 GO:0060291 GO:0051622 GO:0060079 GO:0070555 GO:0031623
GO-Score 0.80 0.80 0.48 0.48 0.48 0.48 0.48 0.48 0.48 0.48
Cellular Component GO:0043190 GO:0042597 GO:0016021 GO:0005634 GO:0005739 GO:0030054 GO:0015629 GO:0030426 GO:0019717 GO:0031092
GO-Score 0.80 0.80 0.60 0.58 0.48 0.48 0.48 0.48 0.48 0.48

(a)CscoreGO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on CscoreGO of the template.


[Click on S693418_results.tar.bz2 to download the tarball file including all modeling results listed on this page]



Please cite the following articles when you use the I-TASSER server:
  • Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. Cell Reports Methods, 1: 100014 (2021).
  • Chengxin Zhang, Peter L. Freddolino, and Yang Zhang. COFACTOR: improved protein function prediction by combining structure, sequence and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017).
  • Jianyi Yang, Yang Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.