TM-align Server

TM-align Results

[an error occurred while processing this directive]

 
 **************************************************************************
 *                        TM-align (Version 20140601)                     *
 * An algorithm for protein structure alignment and comparison            *
 * Based on statistics:                                                   *
 *       0.0 < TM-score < 0.30, random structural similarity              *
 *       0.5 < TM-score < 1.00, in about the same fold                    *
 * Reference: Y Zhang and J Skolnick, Nucl Acids Res 33, 2302-9 (2005)    *
 * Please email your comments and suggestions to: zhanglab@zhanggroup.org          *
 **************************************************************************

Name of Chain_1: A348836                                           
Name of Chain_2: B348836                                           
Length of Chain_1:  154 residues
Length of Chain_2:  146 residues

Aligned length=  143, RMSD=   1.83, Seq_ID=n_identical/n_aligned= 0.245
TM-score= 0.81453 (if normalized by length of Chain_1)
TM-score= 0.85377 (if normalized by length of Chain_2)
(You should use TM-score normalized by length of the reference protein)

(":" denotes aligned residue pairs of d < 5.0 A, "." denotes other aligned residues)
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK--G-HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
 :::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::  : :::::::::::::: :::::::::::::::::::::::::  :::::::::::::::::::::: :     ::
-SLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKS-VADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHV-GFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDALKA-A-----GA

Visualization (Protein-1 in blue and Protein-2 in red)

Superposition of two proteins

Superposition of two proteins with ligands and solvents (when available)

Document downloads

Click A348836.pdb to download the first structure (structure1.pdb) that you submitted.
Click B348836.pdb to download the second structure (structure2.pdb) that you submitted.
Click C348836.pdb to download a Rasmol script file to show the superposed Ca-traces in the aligned regions (To view the structure superposition, please run 'rasmol -script C348836').
Click D348836.pdb to download a Rasmol script file to show the superposed Ca-traces of entire chain (To view the structure superposition, please run 'rasmol -script D348836').
Click E348836.pdb to download a Rasmol script file to show the superposed full-atom structure in the aligned region (To view the structure superposition, please run 'rasmol -script E348836').
Click F348836.pdb to download a Rasmol script file to show the superposed full-atom structure of the entire chain (To view the structure superposition, please run 'rasmol -script F348836').
Click G348836.pdb to download a Rasmol script file to show the superposed full-atom structure of the entire chain with ligands/solvents (To view the structure superposition, please run 'rasmol -script G348836').
All above files will be removed from the server after one month.

Reference:

Back to TM-align Homepage