Page 1 of 1

How can I input multi-chain sequence as fasta?

Posted: Tue Dec 27, 2022 1:02 pm
by jayjayel
Hi,

I've tried to input multi-chain sequence as below.

========================================
>A
EVQLVESGGGLVQPGGSLRLSCAASGFNIHSSSIHWVRQAPGKGLEWVAATYSSFGSITYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYHHPFGYALDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQGVYLFTFGQGTKVEIKRTV
>B
SKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDY
=========================================

However, it didn't work.

How can I predict multi-chain model by D-I-TASSER?

Thank you.

JL

Re: How can I input multi-chain sequence as fasta?

Posted: Tue Dec 27, 2022 6:15 pm
by jlspzw
Dear user,

D-I-TASSER currently does not support multi-chain modeling. We are working on a new server and will let it be released soon.

You can try this link temporarily, but the waiting time may be slightly longer since we are not complete it yet.

https://zhanggroup.org/DeepMSAFold/

Best
IT Team

Re: How can I input multi-chain sequence as fasta?

Posted: Fri Jan 13, 2023 7:00 am
by donglg13
Hi Zhanglab,

Thank you for the server. May I ask whether the stand-alone DeepMSAFold-multimer be available in the nearby feature?

Best,
Liguo

Re: How can I input multi-chain sequence as fasta?

Posted: Sat Jan 14, 2023 1:48 am
by jlspzw
Dear user,

We are working on it, and the package will be available after our manuscript has been published.

Best
IT Team

Re: How can I input multi-chain sequence as fasta?

Posted: Wed Mar 01, 2023 3:01 am
by donglg13
Hi,

Is the DeepMSAfold-multimer server available now?

Liguo

Re: How can I input multi-chain sequence as fasta?

Posted: Wed Mar 01, 2023 2:32 pm
by jlspzw
This server will be available after the paper is published.
If you have targets (should not be too much), you can paste them here, and we can manually do them for you.