Search found 2 matches

by ning
Thu Mar 09, 2023 12:47 pm
Forum: Main Forum
Topic: DeepMSA error from CR-I-TASSER
Replies: 4
Views: 152160

Re: DeepMSA error from CR-I-TASSER

Hi Xi, Thanks for your reply. Yes, MSA calculation caused this error. Actually, I just used the example sequence (GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEDQSVISVDKLRIVACNS) to try to go through the tutorial quickly. Maybe the tmp file holder which is ...
by ning
Sat Mar 04, 2023 3:17 pm
Forum: Main Forum
Topic: DeepMSA error from CR-I-TASSER
Replies: 4
Views: 152160

DeepMSA error from CR-I-TASSER

Hi IT experts, Recently, I tried to use CR-I-TASSER package for model building of Cryo-EM map, whereas, it reported a serious error that was described below: Iteration 1 Prefiltering database . HMMs passed 1st prefilter (gapless profile-profile alignment) : 39 HMMs passed 2nd prefilter (gapped ...