BioLiP

Structure of PDB 1drg Chain A Binding Site BS01

Receptor Information

>1drg Chain A (length=313) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPED
VRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
RKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNT
LLRIAEIARIRVKDISRTDGGRMLIHIGVEKALSLGVTKLVERWISVSGV
ADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSG
QRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNFIRNLDS
ETGAMVRLLEDGD

Ligand information

>1drg Chain B (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tataacttcgtatagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1drg Quasi-equivalence in site-specific recombinase structure and function: crystal structure and activity of trimeric Cre recombinase bound to a three-way Lox DNA junction
Resolution	2.55 Å
Binding residue (original residue number in PDB)	M44 S47 R50 R81 L83 A84 K86 T87 Q90 A131 K132 Q133 Q156 R159 R241 V242 R243 K244 L256 S257 R259 A260 R282 R292 W315 I320 F324 R326
Binding residue (residue number reindexed from 1)	M24 S27 R30 R61 L63 A64 K66 T67 Q70 A111 K112 Q113 Q136 R139 R211 V212 R213 K214 L226 S227 R229 A230 R252 R262 W285 I290 F294 R296

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:1drg, PDBe:1drg, PDBj:1drg
PDBsum	1drg
PubMed	11601846
UniProt	P06956\|RECR_BPP1 Recombinase cre (Gene Name=cre)