Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1rbj Chain A Binding Site BS01

Receptor Information >1rbj Chain A (length=124) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHES LADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTT QANKHIIVACEGNPYVPVHFDASV

Ligand information >1rbj Chain B (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] aaaa

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1rbj Structure of a ribonuclease B+d(pA)4 complex. Resolution 2.7 Å Binding residue (original residue number in PDB) K7 H12 K41 V43 N44 T45 Q69 N71 D83 A109 E111 H119 F120 D121 Binding residue (residue number reindexed from 1) K7 H12 K41 V43 N44 T45 Q69 N71 D83 A109 E111 H119 F120 D121

Enzymatic activity Catalytic site (original residue number in PDB) H12 K41 H119 F120 D121 Catalytic site (residue number reindexed from 1) H12 K41 H119 F120 D121 Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.

Gene Ontology Molecular Function GO:0003676 nucleic acid binding GO:0004519 endonuclease activity GO:0004522 ribonuclease A activity GO:0004540 RNA nuclease activity GO:0005515 protein binding GO:0016829 lyase activity

	Biological Process
GO:0050830	defense response to Gram-positive bacterium

	Cellular Component
GO:0005576	extracellular region

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component