Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 3dvp Chain A Binding Site BS01

Receptor Information >3dvp Chain A (length=85) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] KAVIKNADMSEEMQQDAVDCATQALEKYNIEPDIAAYIKKEFDKKYNPTW HCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG

Ligand information >3dvp Chain C (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] PTRDVATSP

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 3dvp Biochemical and structural characterization of the Pak1-LC8 interaction. Resolution 2.5 Å Binding residue (original residue number in PDB) D12 F62 G63 S64 Y65 V66 T67 H68 E69 T70 F73 Y75 Y77 Binding residue (residue number reindexed from 1) D8 F58 G59 S60 Y61 V62 T63 H64 E65 T66 F69 Y71 Y73

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0003714 transcription corepressor activity GO:0005515 protein binding GO:0042803 protein homodimerization activity GO:0045505 dynein intermediate chain binding GO:0051959 dynein light intermediate chain binding GO:0097718 disordered domain specific binding

	Biological Process
GO:0000132	establishment of mitotic spindle orientation
GO:0007017	microtubule-based process
GO:0007283	spermatogenesis
GO:0007290	spermatid nucleus elongation
GO:0007291	sperm individualization
GO:0007476	imaginal disc-derived wing morphogenesis
GO:0008407	chaeta morphogenesis
GO:0022416	chaeta development
GO:0034454	microtubule anchoring at centrosome
GO:0035220	wing disc development
GO:0045892	negative regulation of DNA-templated transcription
GO:0048477	oogenesis
GO:0051017	actin filament bundle assembly
GO:0141006	piRNA-mediated retrotransposon silencing by heterochromatin formation
GO:1904801	positive regulation of neuron remodeling

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005814	centriole
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005868	cytoplasmic dynein complex
GO:0005874	microtubule
GO:0005875	microtubule associated complex
GO:0015630	microtubule cytoskeleton
GO:0030286	dynein complex
GO:0032991	protein-containing complex
GO:0090571	RNA polymerase II transcription repressor complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component