Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 5wrd Chain A Binding Site BS01

Receptor Information >5wrd Chain A (length=117) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] EKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFL VPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESER DEDGFLYMVYASQETFG

Ligand information >5wrd Chain C (length=19) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] DDAVFDIITDEELCQIQES

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 5wrd The crystal structure of mouse LC3B in complex with the FYCO1 LIR reveals the importance of the flanking region of the LIR motif Resolution 1.9 Å Binding residue (original residue number in PDB) R10 R11 I23 K49 T50 K51 F52 L53 P55 V58 I66 R69 R70 Binding residue (residue number reindexed from 1) R7 R8 I20 K46 T47 K48 F49 L50 P52 V55 I63 R66 R67

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0005515 protein binding

	Biological Process
GO:0000423	mitophagy
GO:0006914	autophagy
GO:0009267	cellular response to starvation
GO:0051649	establishment of localization in cell
GO:0070254	mucus secretion
GO:0070257	positive regulation of mucus secretion

	Cellular Component
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005776	autophagosome
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0005930	axoneme
GO:0012505	endomembrane system
GO:0016020	membrane
GO:0031410	cytoplasmic vesicle
GO:0031966	mitochondrial membrane
GO:0044754	autolysosome

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component