Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1f95 Chain B Binding Site BS01

Receptor Information >1f95 Chain B (length=89) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY NPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Ligand information >1f95 Chain D (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] MSCDKSTQT

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1f95 Structural basis of diverse sequence-dependent target recognition by the 8 kDa dynein light chain. Resolution N/A Binding residue (original residue number in PDB) N10 N61 F62 G63 S64 Y65 V66 T67 H68 E69 T70 Y75 A82 L84 Binding residue (residue number reindexed from 1) N10 N61 F62 G63 S64 Y65 V66 T67 H68 E69 T70 Y75 A82 L84

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0004857 enzyme inhibitor activity GO:0005515 protein binding GO:0019899 enzyme binding GO:0019904 protein domain specific binding GO:0030235 nitric-oxide synthase regulator activity GO:0036487 nitric-oxide synthase inhibitor activity GO:0042802 identical protein binding GO:0044877 protein-containing complex binding GO:0045505 dynein intermediate chain binding GO:0060703 deoxyribonuclease inhibitor activity GO:0097110 scaffold protein binding

	Biological Process
GO:0006915	apoptotic process
GO:0006974	DNA damage response
GO:0007017	microtubule-based process
GO:0007286	spermatid development
GO:0035721	intraciliary retrograde transport
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0042326	negative regulation of phosphorylation
GO:0044458	motile cilium assembly
GO:0045019	negative regulation of nitric oxide biosynthetic process
GO:0051881	regulation of mitochondrial membrane potential
GO:0110027	negative regulation of DNA strand resection involved in replication fork processing
GO:0160040	mitocytosis
GO:1902857	positive regulation of non-motile cilium assembly

	Cellular Component
GO:0000776	kinetochore
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005868	cytoplasmic dynein complex
GO:0005874	microtubule
GO:0005875	microtubule associated complex
GO:0005929	cilium
GO:0008180	COP9 signalosome
GO:0015630	microtubule cytoskeleton
GO:0016020	membrane
GO:0030141	secretory granule
GO:0030286	dynein complex
GO:0035861	site of double-strand break
GO:0072686	mitotic spindle
GO:1904115	axon cytoplasm

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component