Structure of PDB 1knz Chain I Binding Site BS01

Receptor Information

>1knz Chain I (length=154) Species: 10923 (Simian rotavirus A/SA11) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TQQMAVSIINSSFEAAVVAATSALENMGIEYDYQDIYSRVKNKFDFVMDD
SGVKNNPIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRM
MLGIDQKMRVLNACFSVKRIPGKSSSIIKCTKLMRDKLERGEVEVDDSFV
DEKM

Ligand information

>1knz Chain Y (length=5) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ugacc

.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1knz Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer.
Resolution	2.45 Å
Binding residue (original residue number in PDB)	N62 G65 K66 T69 S80 R83 N84 W87 D100 G131 K132 S133 S134 S135
Binding residue (residue number reindexed from 1)	N56 G59 K60 T63 S74 R77 N78 W81 D94 G122 K123 S124 S125 S126
Binding affinity	PDBbind-CN: Kd=79nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:1knz, PDBe:1knz, PDBj:1knz
PDBsum	1knz
PubMed	11792322
UniProt	P03536\|NSP3_ROTS1 Non-structural protein 3

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417