Structure of PDB 5odv Chain I Binding Site BS01

Receptor Information

>5odv Chain I (length=207) Species: 146500 (Watermelon mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PRLQKITKKMNLPTVGGKIILSLDHLLEYKPNQVDLFNTRATKTQFESWY
SAVKVEYDLNDEQMGVIMNGFMVWCIDNGTSPDVNGVWVMMDGEEQVEYP
LKPIVENAKPTLRQIMHHFSDAAEAYIEMRNSESPYMPRYGLLRNLRDRE
LARYAFDFYEVTSKTPNRAREAIAQMKAAALAGINSRLFGLDGNISTNSE
NTERHTA

Ligand information

>5odv Chain i (length=5) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuuu

.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5odv Potyvirus virion structure shows conserved protein fold and RNA binding site in ssRNA viruses.
Resolution	4.0 Å
Binding residue (original residue number in PDB)	G138 S140 D142 R172 Y199 R203
Binding residue (residue number reindexed from 1)	G79 S81 D83 R113 Y140 R144

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0019028	viral capsid

View graph for
Cellular Component

External links

PDB	RCSB:5odv, PDBe:5odv, PDBj:5odv
PDBsum	5odv
PubMed	28948231
UniProt	Q70J31

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417