Structure of PDB 6uai Chain S Binding Site BS01

Receptor Information

>6uai Chain S (length=266) Species: 1390 (Bacillus amyloliquefaciens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AKCVSYGVAQIKAPALHSQGYTGSNVKVAILDTGIDSSHPDLNVAGGASF
VPSETNPFQDNSSGGTHIAGTVLAVAPSASLYAVKVLGADGKGQASWIIN
GIEWAIANNMDVINMSLGSPSGSAAVKAAVDKAVASGVVVVAAAGNSGTS
GSSSTVTYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTL
PGGKYGALSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGD
SFYYGKGLINVEAAAQ

Ligand information

>6uai Chain B (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YSAM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6uai Engineering subtilisin proteases that specifically degrade active RAS.
Resolution	1.2 Å
Binding residue (original residue number in PDB)	G100 K101 G102 A104 I107 S125 L126 G127 S128 S132 N155 G219 T220 S221
Binding residue (residue number reindexed from 1)	G91 K92 G93 A95 I98 S116 L117 G118 S119 S123 N146 G210 T211 S212

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3
Fri May 16 21:29:19 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

/var/www/html/BioLiP/pdb.cgi in <module>()

1701 title=pdb2title(pdbid)

1702 if bs.startswith("BS"):

=> 1703 pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

1704 else:

1705 if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6uai', asym_id = 'S', bs = 'BS01', title = 'Engineering subtilisin proteases that specifically degrade active RAS.'

/var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6uai', asym_id='S', bs='BS01', title='Engineering subtilisin proteases that specifically degrade active RAS.')

1326 display_ec(ec,csaOrig,csaRenu)

1327 if go:

=> 1328 display_go(go,uniprot,pdbid,asym_id)

1329 return pubmed,uniprot

1330

global display_go = <function display_go>, go = '0004252,0006508,0008236', uniprot = '', pdbid = '6uai', asym_id = 'S'

/var/www/html/BioLiP/pdb.cgi in display_go(go='0004252,0006508,0008236', uniprot='', pdbid='6uai', asym_id='S')

484 '''.replace("$namespace_link",namespace_link

485 ).replace("$namespace",namespace

=> 486 ).replace("$uniprot",u

487 ))

488 for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
args = ("local variable 'u' referenced before assignment",)
with_traceback = <built-in method with_traceback of UnboundLocalError object>