BioLiP

Structure of PDB 4x5v Chain A Binding Site BS02

Receptor Information

>4x5v Chain A (length=317) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKYQEACSIPGIGKR
MAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFR
SLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNS
GLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLT
DDLVSQEENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLYFTG
SAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKD
VFRLLGLPYREPAERDW

Ligand information

>4x5v Chain P (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cagtacg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4x5v Nucleotide binding interactions modulate dNTP selectivity and facilitate 8-oxo-dGTP incorporation by DNA polymerase lambda.
Resolution	2.15 Å
Binding residue (original residue number in PDB)	W342 G343 A344 G345 K347 T348 D427 D429 Y505 F506 T507 G508 A510 N513
Binding residue (residue number reindexed from 1)	W84 G85 A86 G87 K89 T90 D169 D171 Y247 F248 T249 G250 A252 N255

Enzymatic activity

Catalytic site (original residue number in PDB)	D427 D429 D490
Catalytic site (residue number reindexed from 1)	D169 D171 D232
Enzyme Commision number	2.7.7.7: DNA-directed DNA polymerase. 4.2.99.-

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity
GO:0016779	nucleotidyltransferase activity
GO:0034061	DNA polymerase activity

	Biological Process
GO:0006281	DNA repair

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:4x5v, PDBe:4x5v, PDBj:4x5v
PDBsum	4x5v
PubMed	26220180
UniProt	Q9UGP5\|DPOLL_HUMAN DNA polymerase lambda (Gene Name=POLL)