BioLiP

Structure of PDB 6za3 Chain A Binding Site BS02

Receptor Information

>6za3 Chain A (length=238) Species: 176299 (Agrobacterium fabrum str. C58) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ATHGGRAVIELREKILSGELPGGMRLFEVSTAELLDISRTPVREALSRLT
EEGLLNRLPGGGFVVRRFGFADVVDAIEVRGVMEGTAARLAAERGVSKVA
LEEIDATVQQLDLCFGDRVDDVDFDGYAALNRIFHHQLAALCGSEMIRRE
VERASSLPFASPSAFLPDKANIGAFRRSLRGAQEQHKAIVAAIVAREGAR
AEAVAREHSRTARTNLEYMIREAPELIAQVPGLALISD

Ligand information

>6za3 Chain F (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atgtatacat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6za3 Characterization of the first tetrameric transcription factor of the GntR superfamily with allosteric regulation from the bacterial pathogen Agrobacterium fabrum.
Resolution	2.05 Å
Binding residue (original residue number in PDB)	T8 H9 S44 T46 P47
Binding residue (residue number reindexed from 1)	T2 H3 S38 T40 P41

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:6za3, PDBe:6za3, PDBj:6za3
PDBsum	6za3
PubMed	33313837
UniProt	A9CJ36