Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 3if7 Chain A Binding Site BS04

Receptor Information >3if7 Chain A (length=142) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI NEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGYISAAE LRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT

Ligand information Ligand ID CA InChI InChI=1S/Ca/q+2 InChIKey BHPQYMZQTOCNFJ-UHFFFAOYSA-N SMILES Software SMILES CACTVS 3.341 [Ca++] ACDLabs 10.04 OpenEye OEToolkits 1.5.0 [Ca+2] Formula Ca Name CALCIUM ION ChEMBL DrugBank DB14577 ZINC PDB chain 3if7 Chain A Residue 152 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 3if7 Structure and mechanism of calmodulin binding to a signaling sphingolipid reveal new aspects of lipid-protein interactions Resolution 1.6 Å Binding residue (original residue number in PDB) D129 D131 D133 Q135 E140 Binding residue (residue number reindexed from 1) D125 D127 D129 Q131 E136 Annotation score 4

Enzymatic activity Catalytic site (original residue number in PDB) V35 Catalytic site (residue number reindexed from 1) V33 Enzyme Commision number ?

Gene Ontology Molecular Function GO:0005509 calcium ion binding GO:0005515 protein binding GO:0019904 protein domain specific binding GO:0046872 metal ion binding

	Biological Process
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0060315	negative regulation of ryanodine-sensitive calcium-release channel activity
GO:0060316	positive regulation of ryanodine-sensitive calcium-release channel activity

	Cellular Component
GO:0000922	spindle pole
GO:0005737	cytoplasm
GO:0005819	spindle
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0032991	protein-containing complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component