Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 5g08 Chain A Binding Site BS04

Receptor Information >5g08 Chain A (length=180) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] KNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYK QFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHW AFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDKIFD QMDKNHDDRLTLEEFREGSKADPRMVQALS

Ligand information Ligand ID Z80 InChI InChI=1S/C17H19ClN2S/c1-19(2)10-5-11-20-14-6-3-4-7-16(14)21-17-9-8-13(18)12-15(17)20/h3-4,6-9,12H,5,10-11H2,1-2H3 InChIKey ZPEIMTDSQAKGNT-UHFFFAOYSA-N SMILES Software SMILES CACTVS 3.352 CN(C)CCCN1c2ccccc2Sc3ccc(Cl)cc13 OpenEye OEToolkits 1.7.0 CN(C)CCCN1c2ccccc2Sc3c1cc(cc3)Cl Formula C17 H19 Cl N2 S Name 3-(2-chloro-10H-phenothiazin-10-yl)-N,N-dimethylpropan-1-amine; Chlorpromazine ChEMBL CHEMBL71 DrugBank DB00477 ZINC ZINC000000044027 PDB chain 5g08 Chain A Residue 1187 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 5g08 Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome. Resolution 1.52 Å Binding residue (original residue number in PDB) F72 F85 T92 Binding residue (residue number reindexed from 1) F69 F82 T89 Annotation score 1

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0005509 calcium ion binding GO:0005515 protein binding GO:0008048 calcium sensitive guanylate cyclase activator activity GO:0046872 metal ion binding

	Biological Process
GO:0007268	chemical synaptic transmission
GO:0007269	neurotransmitter secretion
GO:0007528	neuromuscular junction development
GO:0016192	vesicle-mediated transport
GO:0046928	regulation of neurotransmitter secretion

	Cellular Component
GO:0005737	cytoplasm
GO:0008021	synaptic vesicle

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component