BioLiP

Structure of PDB 3o9x Chain A

Receptor sequence

>3o9xA (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEE
SDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAF
SRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR

3D structure

PDB

3o9x Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.

Chain

Resolution

2.0999 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	F22 R23 G93 G94 N97 R101 Y102 A107 Q108	F23 R24 G94 G95 N98 R102 Y103 A108 Q109	PDBbind-CN: Kd=0.8nM
BS02	dna	A	T84 Q85 N97 S100 H110	T85 Q86 N98 S101 H111	PDBbind-CN: Kd=0.8nM
BS03	ZN	A	C3 C6 C37 C40	C4 C7 C38 C41

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0042803	protein homodimerization activity
GO:0043565	sequence-specific DNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0044010	single-species biofilm formation

	Cellular Component
GO:0110001	toxin-antitoxin complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:3o9x, PDBe:3o9x, PDBj:3o9x
PDBsum	3o9x
PubMed	21068382
UniProt	Q46864\|MQSA_ECOLI Antitoxin MqsA (Gene Name=mqsA)