Structure of PDB 7d63 Chain A9 |
>7d63A9 (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
NILSSHLEANSTEILDDLMSGSWTEPEIKKFILTKINTVDHLSKIFLTIS KSITQNPWNEENLLPLWLKWLLTLKSGELNSIKDKHTKKNCKHLKSALRS SEEILPVLLGIQGRLEMLRRQAKLREDL |
|
PDB | 7d63 Cryo-EM structure of 90S preribosome with inactive Utp24 (state C) |
Chain | A9 |
Resolution | 12.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
A9 |
K483 S484 R487 |
K95 S96 R99 |
|
|
|
|