Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 5zji Chain C

Receptor sequence >5zjiC (length=81) Species: 381124 (Zea mays subsp. mays) [Search protein sequence] MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVG CKRCESACPTDFLSVRVYLGPETTRSMALSY

3D structure PDB 5zji Structure of the maize photosystem I supercomplex with light-harvesting complexes I and II. Chain C Resolution 3.3 Å 3D structure [Spin on] [Spin off] [Reset orientation] [High quality] [Low quality] [White background] [Black background] [Download] [Download structure with residue number starting from 1]

Enzymatic activity Enzyme Commision number 1.97.1.12: photosystem I.

Interaction with ligand Site # Ligand Ligand chain Binding residues on receptor (original residue number in PDB) Binding residues on receptor (residue number reindexed from 1) Binding affinity BS01 SF4 C C21 P22 V25 C48 G50 C51 K52 R53 C54 V67 C21 P22 V25 C48 G50 C51 K52 R53 C54 V67 BS02 SF4 C C11 I12 G13 C14 Q16 C17 C58 P59 C11 I12 G13 C14 Q16 C17 C58 P59

Gene Ontology Molecular Function GO:0009055 electron transfer activity GO:0016491 oxidoreductase activity GO:0046872 metal ion binding GO:0051539 4 iron, 4 sulfur cluster binding

	Biological Process
GO:0009773	photosynthetic electron transport in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009534	chloroplast thylakoid
GO:0009536	plastid
GO:0009579	thylakoid
GO:0016020	membrane
GO:0042651	thylakoid membrane

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component