You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	Lorcaserin
Molecular formula	C11H14ClN
IUPAC name	(5R)-7-chloro-5-methyl-2,3,4,5-tetrahydro-1H-3-benzazepine
Molecular weight	195.69
Hydrogen bond acceptor	1
Hydrogen bond donor	1
XlogP	2.7
Synonyms	(5R)-7-chloro-5-methyl-2,3,4,5-tetrahydro-1H-3-benzazepine 616202-92-7 AN-6779 BDBM50161646 CTK8B8482 FCH873876 LS-193332 TX-017673 10-chloro-2-methyl-4-azabicyclo[5.4.0]undeca-8,10,12-triene AB52744 APD356 CAS-616202-92-7 DB04871 HSDB 8128 SB16626 XTTZERNUQAFMOF-QMMMGPOBSA-N (1R)-8-chloro-1-methyl-2,3,4,5-tetrahydro-1H-3-benzazepine AKOS006326204 AX8136671 CHEMBL360328 DSSTox_RID_82856 Lorcaserin [INN] Tox21_113018 (R)-8-Chloro-1-methyl-2,3,4,5-tetrahydro-1H-3-benzazepine 637E494O0Z ANW-60436 Belvig D01JMC FT-0670852 NCGC00182550-01 UNII-637E494O0Z 1H-3-Benzazepine, 8-chloro-2,3,4,5-tetrahydro-1-methyl-, (1R)- AC-553 API0005054 CHEBI:65353 DSSTox_CID_28585 HY-11093 SCHEMBL169382 ZINC6733300 (1R)-8-chloro-2,3,4,5-tetrahydro-1-methyl-1H-3-benzazepine AM81248 BC224451 CS-1232 DTXSID3048659 Lorqess Tox21_113018_1 (R)-8-chloro-1-methyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine AB0148401 APD 356 Belviq GTPL2941 NCGC00182550-02 W-5409 202L927 AJ-56780 AR-10A DSSTox_GSID_48659 TL80074203 [ Show all ]
Inchi Key	XTTZERNUQAFMOF-QMMMGPOBSA-N
Inchi ID	InChI=1S/C11H14ClN/c1-8-7-13-5-4-9-2-3-10(12)6-11(8)9/h2-3,6,8,13H,4-5,7H2,1H3/t8-/m0/s1
PubChem CID	11658860
ChEMBL	CHEMBL360328
IUPHAR	2941
BindingDB	50161646
DrugBank	DB04871
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Parameter	Value	Reference	Database source
	N/A	N/A	DrugBank
EC50	1.8 nM	PMID26704965	BindingDB
EC50	1.82 nM	PMID26704965	ChEMBL
EC50	2.7 nM	PMID19284718, PMID26704965	BindingDB,ChEMBL
EC50	3.6 nM	PMID25633969	BindingDB,ChEMBL
EC50	7.943 nM	PMID18095642	ChEMBL
EC50	7.94328 nM	PMID18252809	IUPHAR
EC50	9.0 nM	PMID23177783, PMID21195614	BindingDB,ChEMBL
EC50	9.0 nM	PMID23177783	BindingDB
EC50	11.0 nM	PMID15713408	BindingDB,ChEMBL
EC50	210.0 nM	PMID21195614	BindingDB,ChEMBL
Emax	84.0 %	PMID21195614	ChEMBL
Emax	98.0 %	PMID26704965	ChEMBL
Emax	99.0 %	PMID25633969	ChEMBL
Emax	100.0 %	PMID21195614	ChEMBL
Emax	124.0 %	PMID19284718	ChEMBL
Ki	15.0 nM	PMID24084296, PMID21195614	BindingDB,ChEMBL
Ki	15.8489 nM	PMID18252809	IUPHAR
Ki	167.0 nM	PMID21195614	BindingDB,ChEMBL
Ki	257.0 nM	PMID19284718	BindingDB,ChEMBL
Maximum response	100.0 %	PMID15713408	ChEMBL

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417