Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Adenosine receptor A2a
Species	Homo sapiens (Human)
Gene	ADORA2A
Synonym	RDC8 adenosine receptor A2a A2A receptor A2-AR
Disease	Radionuclide imaging Diabetic foot ulcer Glaucoma Hypertension Neuropathic pain Pain Coronary disorder diagnosis Parkinson's disease Allergic rhinitis Arteriosclerosis Asthma; Chronic obstructive pulmonary disease [ Show all ]
Length	412
Amino acid sequence	MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
UniProt	P29274
Protein Data Bank	4ug2, 4eiy, 3vga, 3vg9, 3uzc, 3uza, 3rfm, 3rey, 3pwh, 5iu4, 3eml, 2ydv, 2ydo, 3qak, 4uhr, 5g53, 5olh, 5olo, 5olv, 5olz, 5om1, 5om4, 5uvi, 5vra, 5wf5, 5wf6, 6aqf, 6gdg, 5olg, 5nm4, 5iu7, 5iu8, 5iua, 5iub, 5jtb, 5k2a, 5k2b, 5mzj, 5mzp, 5n2r, 5nlx, 5nm2
GPCR-HGmod model	P29274
3D structure model	This structure is from PDB ID 4ug2.
BioLiP	BL0213760, BL0350712, BL0350713,BL0350714,BL0350715, BL0353317,BL0353318, BL0357562, BL0357563,BL0357564,BL0357565, BL0357566, BL0357567,BL0357568,BL0357569, BL0379362,BL0379363,BL0379364, BL0379725, BL0379726,BL0379727,BL0379728, BL0379729, BL0385550, BL0350708,BL0350709,BL0350710,, BL0350707, BL0350703,BL0350704,BL0350705,, BL0215974, BL0215975, BL0227995, BL0227996, BL0227997,BL0227998,BL0227999, BL0312021,BL0312022, BL0312023, BL0350692, BL0350693,BL0350694,BL0350695,, BL0350697, BL0350698,BL0350699,BL0350700,, BL0350702, BL0385551,BL0385552,BL0385553, BL0385557, BL0385558,BL0385559,BL0385560,, BL0401931,BL0401932,BL0401933, BL0401934, BL0401935,BL0401936,BL0401937, BL0401938, BL0401939,BL0401940,BL0401941,, BL0401943, BL0401944,BL0401945,BL0401946,, BL0401948, BL0401949,BL0401950,BL0401951,, BL0401954,BL0401955,BL0401956,, BL0405662, BL0405663, BL0401930, BL0401927,BL0401928,BL0401929, BL0401926, BL0385572, BL0385573,BL0385574,BL0385575, BL0393144, BL0393145, BL0393146, BL0393147,BL0393148,BL0393149, BL0393150, BL0393151,BL0393152, BL0398902, BL0398903,BL0398904,BL0398905, BL0401593, BL0401594,BL0401595,BL0401596, BL0414567, BL0213751, BL0401953, BL0379361, BL0130764, BL0130785, BL0152618, BL0194187, BL0195884, BL0199981, BL0200022
Therapeutic Target Database	T77365
ChEMBL	CHEMBL251
IUPHAR	19
DrugBank	BE0000924

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
47	CHEMBL574416	C17H12N4O	288.31	3 / 1	2.7	Yes
50	CHEMBL2113609	C17H25N5O4	363.418	8 / 4	0.8	Yes
70	Pyrimidin-4-ylacetamide, 26	C19H24N6O2	368.441	6 / 1	2.0	Yes
157	CHEMBL601208	C18H16N4O3S	368.411	6 / 2	4.3	Yes
188	CHEMBL473650	C21H14N6O2	382.383	5 / 1	2.8	Yes
441675	CHEMBL201449	C26H26N4O7	506.515	7 / 2	2.7	No
236	CHEMBL437168	C26H26ClN7O6	567.987	10 / 5	2.2	No
366	CHEMBL573125	C28H31ClN6O5	567.043	9 / 4	2.5	No
441688	CHEMBL3394262	C40H48N14O6	820.916	18 / 5	N/A	No
478	CHEMBL38304	C28H32N6O4	516.602	6 / 2	3.2	No
670	CHEMBL343256	C19H21N5O	335.411	4 / 1	4.5	Yes
689	CHEMBL196259	C16H16N8	320.36	6 / 1	2.3	Yes
521468	CHEMBL3827623	C26H36N6O3	480.613	6 / 0	3.9	Yes
798	CHEMBL2170801	C22H30ClN5O2	431.965	6 / 3	4.2	Yes
802	CHEMBL468370	C16H11N3O	261.284	4 / 1	3.2	Yes
809	CHEMBL2089347	C27H24ClN5O2	485.972	6 / 3	4.2	Yes
828	CHEMBL382194	C18H20IN7O4	525.307	8 / 5	0.4	No
872	CHEMBL481383	C20H23N5O2	365.437	3 / 0	3.6	Yes
896	CHEMBL561167	C18H22N4O3	342.399	4 / 1	3.3	Yes
935	2-amino-4-(1,3-benzodioxol-5-yl)-6-methoxypyridine-3,5-dicarbonitrile	C15H10N4O3	294.27	7 / 1	2.2	Yes
993	CHEMBL1927632	C8H7N7O	217.192	7 / 2	-0.1	Yes
998	CHEMBL208311	C25H30N6O4	478.553	8 / 4	2.7	Yes
1042	Pyrimidin-4-ylacetamide, 9	C20H24N6O3	396.451	7 / 1	1.7	Yes
1136	CHEMBL2313295	C18H16F3N3O2	363.34	5 / 0	3.1	Yes
1201	CHEMBL178846	C22H25ClN6O5	488.929	9 / 4	1.3	Yes
553256	MRS-1042	C24H28O5	396.483	5 / 0	6.0	No
1449	CHEMBL3121728	C27H31ClN6O3	523.034	6 / 1	3.6	No
1466	CHEMBL540094	C24H30Cl2N4O3	493.429	6 / 2	N/A	N/A
1477	CHEMBL1650163	C18H13F2N3O	325.319	5 / 1	3.2	Yes
441727	SCHEMBL1497826	C22H20Cl3N3OS	480.832	5 / 1	6.5	No
1560	hexachlorophene	C13H6Cl6O2	406.889	2 / 2	7.5	No
441734	CID 118733042	C10H8N4OS	232.261	4 / 1	1.1	Yes
1714	CHEMBL1094143	C25H19N5O	405.461	4 / 1	4.6	Yes
1772	CHEMBL2313274	C16H17N5O2	311.345	4 / 1	0.8	Yes
1817	CHEMBL603861	C21H20F2N4O4	430.412	7 / 0	2.2	Yes
557350	CHEMBL124887	C23H20N6O2	412.453	6 / 2	3.8	Yes
1992	CHEMBL515442	C19H20ClIN6O5	574.76	9 / 4	1.7	No
2058	CHEMBL407372	C28H25F6N5O4	609.529	11 / 1	4.9	No
2121	CHEMBL2112158	C21H23ClN6O3	442.904	7 / 4	1.7	Yes
441759	CHEMBL434692	C18H14BrNOS	372.28	3 / 1	5.8	No
2243	CHEMBL259178	C16H15N5O2	309.329	6 / 2	1.9	Yes
557360	CHEMBL2312720	C18H13N3O3	319.32	4 / 1	2.9	Yes
441764	CHEMBL3410319	C23H15F4N5O4	501.398	11 / 0	3.9	No
2308	CHEMBL218837	C19H20ClN7O5	461.863	9 / 5	0.9	Yes
2317	CHEMBL366216	C19H25N7	351.458	6 / 3	4.2	Yes
521526	CHEMBL3785142	C14H17NO3S	279.354	4 / 1	1.8	Yes
2992	RWJ-68354	C19H15FN4O	334.354	5 / 2	3.3	Yes
3059	CHEMBL376920	C19H15N3	285.35	3 / 1	4.4	Yes
3096	CHEMBL131242	C33H42N8O4	614.751	10 / 5	3.7	No
3104	Pyrimidin-4-ylacetamide, 6	C22H29N7O2	423.521	7 / 1	2.2	Yes
3185	CHEMBL201847	C26H28N4O4	460.534	4 / 1	3.5	Yes
3621	CHEMBL1927430	C19H28N8O5	448.484	11 / 3	1.0	No
3624	CHEMBL574502	C23H22ClN7O3	479.925	7 / 1	4.3	Yes
3673	CHEMBL490250	C17H22ClN5O4	395.844	8 / 4	2.3	Yes
3789	CHEMBL186443	C19H20N8O4	424.421	10 / 4	-0.4	Yes
3814	CHEMBL257256	C16H18ClN3O2S	351.849	5 / 1	3.9	Yes
557391	CHEMBL124724	C18H20N6	320.4	4 / 1	4.3	Yes
3850	CEP-11981	C28H27N7O	477.572	5 / 2	3.9	Yes
3853	316173-57-6	C20H19N7O2	389.419	7 / 1	2.7	Yes
557393	CHEMBL123144	C16H15BrN6	371.242	4 / 1	4.1	Yes
3957	CHEMBL2391832	C20H13N3O3S	375.402	6 / 1	3.8	Yes
4041	CHEMBL428716	C22H29N7O6	487.517	11 / 4	1.1	No
517338	SCHEMBL246621	C29H29N5O3S	527.643	8 / 2	4.1	No
4088	CHEMBL235717	C24H18ClN5O3	459.89	5 / 1	5.7	No
557401	CHEMBL3800558	C37H41N5O4	619.766	7 / 4	5.7	No
4117	CHEMBL465640	C17H11F3N4	328.298	6 / 1	4.0	Yes
4164	CHEMBL457014	C18H20N4O5	372.381	5 / 2	2.9	Yes
4211	CHEMBL278805	C22H22Cl2N8O3S	549.431	9 / 1	2.7	No
4238	CHEMBL446264	C8H10BrN5	256.107	4 / 1	1.4	Yes
4332	CHEMBL123669	C20H19ClN4O	366.849	4 / 0	5.4	No
4353	CHEMBL574701	C21H17N7O5	447.411	10 / 2	2.2	Yes
4357	CHEMBL22355	C21H17N7O5	447.411	10 / 2	2.2	Yes
4370	CHEMBL1082391	C19H19N3O4	353.378	6 / 1	2.1	Yes
4384	CHEMBL3087709	C23H17N5O2	395.422	5 / 1	3.6	Yes
4438	CHEMBL574490	C19H13Cl2N7O2	442.26	6 / 1	3.2	Yes
4512	CHEMBL575605	C31H25N7O2	527.588	6 / 1	5.4	No
441888	CHEMBL3125715	C22H29N5O2	395.507	6 / 3	3.1	Yes
521592	871266-83-0	C11H6ClN5O2S	307.712	7 / 1	3.7	Yes
4753	CHEMBL27376	C20H20ClIN6O3	554.773	7 / 4	2.0	No
4758	CHEMBL376778	C20H19N3O	317.392	3 / 1	4.1	Yes
4817	CHEMBL1171381	C31H37N5O4	543.668	5 / 0	4.4	No
4867	CHEMBL611552	C20H22N10O7	514.459	14 / 5	-0.1	No
4868	CHEMBL2413111	C20H22N10O7	514.459	14 / 5	-0.1	No
4870	CHEMBL611552	C20H22N10O7	514.459	14 / 5	-0.1	No
4878	CHEMBL1258192	C22H23N7O2	417.473	7 / 1	3.5	Yes
4934	CHEMBL255861	C20H15ClN4O3S	426.875	7 / 1	3.9	Yes
4967	CHEMBL429420	C24H24N6O	412.497	5 / 1	3.8	Yes
4996	CHEMBL2042308	C49H58N8O5	839.054	10 / 6	9.0	No
4997	CHEMBL1766351	C21H15ClN4O2	390.827	3 / 2	4.1	Yes
5152	CHEMBL1088665	C23H24N6O	400.486	7 / 2	2.1	Yes
5194	triazine-4-carboxamide, 6	C15H12ClN5O2	329.744	6 / 2	2.1	Yes
441910	CHEMBL3415043	C13H12N4O2S	288.325	6 / 2	2.2	Yes
463519	CHEMBL3612943	C20H20ClN9O3S	501.95	10 / 4	1.0	No
5372	CHEMBL3093315	C17H17N5O2S	355.416	5 / 0	1.4	Yes
5402	CHEMBL370588	C23H21BrN4O4	497.349	4 / 2	3.6	Yes
5608	UNII-29S2U9DRGS	C27H28N6O5	516.558	8 / 1	5.7	No
5624	CHEMBL589513	C43H56ClN11O7S	906.501	12 / 9	1.2	No
5626	CHEMBL583748	C43H56ClN11O7S	906.501	12 / 9	1.2	No
5630	2-(1-hexynyl)adenosine	C16H21N5O4	347.375	8 / 4	1.3	Yes
547959	CHEMBL3981215	C16H21N5O4	347.375	8 / 4	1.3	Yes