Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●ATGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●TM-search ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●rMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●HPmod ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Trace amine-associated receptor 7b
Species	Rattus norvegicus (Rat)
Gene	Taar7b
Synonym	TaR-12 TaR-7b Trace amine receptor 12 Trace amine receptor 7b
Disease	N/A for non-human GPCRs
Length	358
Amino acid sequence	MATDDDRFPWDQDSILSRDLLSASSMQLCYEKLNRSCVRSPYSPGPRLILYAVFGFGAVLAVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVEGCWYFGDIYCKFHSSFDGSFCYSSIFHLCFISADRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSFSLFYTGVNEAGLEDLVSALTCVGGCQIAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAKQQAQNIEKMGKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLGFVTPTYVYEILVWIGYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE
UniProt	Q923X8
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL2176813
IUPHAR	N/A
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
3316	US8802673, 145	C16H16F4N4O2	372.324	10 / 2	2.3	Yes
3319	US8802673, 145	C16H16F4N4O2	372.324	10 / 2	2.3	Yes
8421	CHEMBL3641759	C16H15F5N4O2	390.314	11 / 2	2.7	No
8951	CHEMBL3641756	C14H15ClN4O	290.751	5 / 2	1.6	Yes
9803	CHEMBL3641757	C16H16F4N4O2	372.324	10 / 2	2.3	Yes
11757	CHEMBL3701909	C15H16BrN3O	334.217	4 / 2	2.4	Yes
14388	CHEMBL3641755	C14H15ClN4O	290.751	5 / 2	1.6	Yes
17472	CHEMBL3641723	C15H15F3N4O	324.307	8 / 2	2.0	Yes
18473	CHEMBL3701943	C20H20N2O	304.393	3 / 2	3.9	Yes
19029	CHEMBL3701925	C17H16ClN3OS	345.845	5 / 2	3.9	Yes
20346	CHEMBL3702002	C14H15ClN4O	290.751	5 / 2	1.7	Yes
20347	CHEMBL3701905	C14H15ClN4O	290.751	5 / 2	1.7	Yes
20350	CHEMBL3702001	C14H15ClN4O	290.751	5 / 2	1.7	Yes
21465	CHEMBL3641733	C16H20N4O3	316.361	7 / 2	1.7	Yes
21772	CHEMBL3701903	C21H24ClF3N2	396.882	5 / 2	6.1	No
26172	CHEMBL3641741	C16H17F5N2OS	380.377	8 / 2	5.9	No
26812	CHEMBL3701974	C14H15N5O3	301.306	7 / 2	0.9	Yes
26830	CHEMBL3701919	C18H22N2O2	298.386	4 / 2	2.6	Yes
29384	CHEMBL3641724	C19H18F2N6O3	416.389	11 / 2	2.2	No
30178	CHEMBL3701950	C20H20ClN3O	353.85	4 / 2	3.7	Yes
32164	CHEMBL3641701	C18H18N4O2	322.368	6 / 2	1.8	Yes
32166	CHEMBL3641700	C18H18N4O2	322.368	6 / 2	1.8	Yes
32369	CHEMBL3641693	C17H22N4O3	330.388	7 / 2	0.9	Yes
32371	CHEMBL3641692	C17H22N4O3	330.388	7 / 2	0.9	Yes
32667	CHEMBL3701972	C18H24N4O	312.417	5 / 2	2.6	Yes
40721	CHEMBL3641749	C14H15ClN4O	290.751	5 / 2	2.1	Yes
40778	CHEMBL3701902	C20H22ClF3N2	382.855	5 / 2	5.8	No
43595	CHEMBL3701960	C15H15Br2N3O	413.113	4 / 2	3.1	Yes
45187	BDBM6698	C15H14F4N4O	342.298	9 / 2	2.1	Yes
45190	US8802673, 134	C15H14F4N4O	342.298	9 / 2	2.1	Yes
45191	BDBM6566	C15H14F4N4O	342.298	9 / 2	2.1	Yes
47188	CHEMBL3641694	C14H18N4O	258.325	4 / 2	1.1	Yes
48101	CHEMBL3641739	C17H20N4O	296.374	5 / 2	1.7	Yes
48675	CHEMBL3641740	C17H19FN4O	314.364	6 / 2	1.8	Yes
49775	CHEMBL3702012	C17H22N4O	298.39	5 / 2	2.5	Yes
51493	CHEMBL3641727	C18H18N4O	306.369	5 / 2	2.4	Yes
55665	CHEMBL3640008	C16H15ClF3N3O	357.761	7 / 2	3.3	Yes
57772	CHEMBL3641732	C16H20N4O	284.363	5 / 2	1.9	Yes
64552	CHEMBL3702021	C17H22N4O2	314.389	6 / 2	1.9	Yes
64554	CHEMBL3702020	C17H22N4O2	314.389	6 / 2	1.9	Yes
68872	CHEMBL3641729	C15H16F2N4O2	322.316	8 / 2	2.0	Yes
73935	CHEMBL3701991	C17H22N4O	298.39	5 / 2	2.4	Yes
73936	CHEMBL3701920	C17H22N4O	298.39	5 / 2	2.4	Yes
74477	CHEMBL3701929	C17H18Cl2N2O	337.244	3 / 2	3.7	Yes
76115	CHEMBL3641714	C20H22N4O	334.423	4 / 2	2.7	Yes
76117	CHEMBL3641713	C20H22N4O	334.423	4 / 2	2.7	Yes
76601	CHEMBL3701958	C16H16ClFN2O	306.765	4 / 2	3.2	Yes
84092	CHEMBL3701938	C16H19N3O2	285.347	5 / 2	1.7	Yes
85140	US8802673, 169	C15H14ClF3N4O	358.749	8 / 2	2.6	Yes
85828	CHEMBL3701961	C16H18BrN3O	348.244	4 / 2	2.8	Yes
92929	CHEMBL3641738	C16H16F4N4O2	372.324	10 / 2	2.6	Yes
94014	CHEMBL3702011	C19H20N4O	320.396	4 / 3	2.8	Yes
99060	US8802673, 167	C16H17F3N4O	338.334	8 / 2	2.4	Yes
99062	US8802673, 167	C16H17F3N4O	338.334	8 / 2	2.4	Yes
99138	CHEMBL3641734	C16H16ClF3N4O2	388.775	9 / 2	2.8	Yes
103763	CHEMBL3641726	C14H16N4O	256.309	5 / 2	1.3	Yes
110238	CHEMBL3701927	C17H21N3O2	299.374	5 / 2	1.7	Yes
113680	CHEMBL3701924	C18H19F3N2O2	352.357	7 / 2	3.6	Yes
113780	CHEMBL3641712	C15H18N4O	270.336	5 / 2	1.1	Yes
116280	CHEMBL3701907	C16H17ClN2O	288.775	3 / 2	3.3	Yes
125497	CHEMBL3701901	C17H17BrF3N3	400.243	6 / 2	4.0	Yes
128716	CHEMBL3701983	C17H20BrN3O	362.271	4 / 2	3.2	Yes
129669	CHEMBL3641754	C15H14ClF3N4O	358.749	8 / 2	2.6	Yes
129829	CHEMBL3701910	C16H16F3N3O	323.319	7 / 2	2.6	Yes
138742	CHEMBL3701911	C15H18N4O2	286.335	6 / 2	1.1	Yes
140425	CHEMBL3641730	C15H17ClN4O2	320.777	6 / 2	2.4	Yes
145152	CHEMBL3701930	C17H19FN2O	286.35	4 / 2	2.7	Yes
145605	CHEMBL3701918	C15H15F3N4O	324.307	8 / 2	2.0	Yes
145607	CHEMBL3701993	C15H15F3N4O	324.307	8 / 2	2.0	Yes
148856	CHEMBL3641748	C15H15F3N4O	324.307	8 / 2	2.0	Yes
148943	CHEMBL3701934	C17H18ClFN2O	320.792	4 / 2	3.2	Yes
149438	CHEMBL3641747	C15H14F4N4O	342.298	9 / 2	2.1	Yes
149441	CHEMBL3641746	C15H14F4N4O	342.298	9 / 2	2.1	Yes
149624	CHEMBL3701969	C18H21ClN2O	316.829	3 / 2	3.6	Yes
150885	CHEMBL3641750	C15H15F3N4O	324.307	8 / 2	2.0	Yes
151877	CHEMBL3701949	C18H17ClN4O	340.811	5 / 2	3.1	Yes
152160	CHEMBL3701936	C16H18FN3O	287.338	5 / 2	1.5	Yes
156143	CHEMBL3641703	C15H18F2N4O	308.333	6 / 2	1.9	Yes
156223	CHEMBL3702008	C18H22N4O	310.401	5 / 2	2.4	Yes
156225	CHEMBL3702009	C18H22N4O	310.401	5 / 2	2.4	Yes
156227	CHEMBL3701985	C18H22N4O	310.401	5 / 2	2.4	Yes
171436	CHEMBL3701931	C16H18ClN3O	303.79	4 / 2	2.3	Yes
172516	CHEMBL3641728	C16H17F3N4O	338.334	8 / 2	2.4	Yes
172865	CHEMBL3641742	C17H19FN4O	314.364	6 / 2	2.1	Yes
172867	CHEMBL3641745	C17H19FN4O	314.364	6 / 2	2.1	Yes
175323	CHEMBL3701942	C15H16FN3O	273.311	5 / 2	1.5	Yes
183705	CHEMBL3701963	C16H18BrN3O	348.244	4 / 2	2.8	Yes
186387	CHEMBL3701964	C17H18N2O3	298.342	5 / 2	2.3	Yes
187517	CHEMBL3701953	C19H18ClN3O	339.823	4 / 2	3.7	Yes
191243	CHEMBL3701970	C17H20ClN3O2	333.816	5 / 2	2.7	Yes
193924	CHEMBL3701915	C15H15N5O	281.319	6 / 2	0.8	Yes
193961	CHEMBL3701951	C19H18ClN3O	339.823	4 / 2	3.7	Yes
195800	CHEMBL3701984	C17H20N4O	296.374	5 / 2	2.0	Yes
195803	CHEMBL3701916	C17H20N4O	296.374	5 / 2	2.0	Yes
199703	CHEMBL3701935	C19H24N2O	296.414	3 / 2	3.4	Yes
200170	CHEMBL3701940	C16H16F3N3O	323.319	7 / 2	2.6	Yes
201466	CHEMBL3701982	C17H20ClN3O	317.817	4 / 2	3.1	Yes
201668	CHEMBL3701980	C15H17ClN4O	304.778	5 / 2	2.1	Yes
202064	CHEMBL3701947	C20H21N3O	319.408	4 / 2	3.2	Yes
204992	CHEMBL3701944	C17H19BrN2O	347.256	3 / 2	3.3	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417