Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●ATGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●TM-search ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●rMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●HPmod ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	G-protein coupled receptor 35
Species	Mus musculus (Mouse)
Gene	Gpr35
Synonym	G-protein coupled receptor 3 GPR35 KYNA receptor Kynurenic acid receptor
Disease	N/A for non-human GPCRs
Length	307
Amino acid sequence	MNSTTCNSTLTWPASVNNFFIIYSALLLVLGLLLNSVALWVFCYRMHQWTETRIYMTNLAVADLCLLCSLPFVLYSLKYSSSDTPVCQLSQGIYLANRYMSISLVTAIAVDRYVAVRHPLRARELRSPRQAAAVCVALWVIVVTSLVVRWRLGMQEGGFCFSSQTRRNFSTTAFSLLGFYLPLAIVVFCSLQVVTVLSRRPAADVGQAEATQKATHMVWANLAVFVICFLPLHVVLTVQVSLNLNTCAARDTFSRALSITGKLSDTNCCLDAICYYYMAREFQEASKPATSSNTPHKSQDSQILSLT
UniProt	Q9ES90
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL2390813
IUPHAR	102
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
14705	CHEMBL2392162	C18H12FNO6	357.293	7 / 2	2.2	Yes
22235	CHEMBL2392173	C18H9BrN2O5	413.183	6 / 2	2.5	Yes
24622	CHEMBL2392148	C17H17NO5	315.325	5 / 2	2.5	Yes
28938	CHEMBL2392164	C17H10ClNO5	343.719	5 / 2	2.7	Yes
42833	CHEMBL2392150	C18H13NO5	323.304	5 / 2	2.1	Yes
43525	CHEMBL2392154	C17H10N2O7	354.274	7 / 2	1.9	Yes
44141	CHEMBL2392152	C20H12N2O5	360.325	6 / 2	2.7	Yes
47055	CHEMBL2392175	C19H14BrNO6	432.226	6 / 2	3.1	Yes
66520	CHEMBL2392151	C21H13NO5	359.337	5 / 2	3.4	Yes
77346	CHEMBL2392183	C17H11BrN2O6	419.187	7 / 2	2.0	Yes
80582	CHEMBL2392161	C17H8Cl2FNO5	396.151	6 / 2	3.5	Yes
87489	CHEMBL2392178	C18H10BrNO7	432.182	7 / 2	2.6	Yes
553807	kynurenic acid	C10H7NO3	189.17	4 / 2	1.3	Yes
123699	CHEMBL2392166	C17H9ClN2O7	388.716	7 / 2	2.6	Yes
124183	CHEMBL2392182	C17H11BrN2O6	419.187	7 / 2	2.0	Yes
127242	CHEMBL2392169	C18H12BrNO5	402.2	5 / 2	3.2	Yes
137054	Cromoglycate	C23H14O11-2	466.354	11 / 1	3.2	No
155273	CHEMBL2392142	C10H5NO6	235.151	6 / 1	1.5	Yes
165224	CHEMBL2392160	C17H8Cl2FNO5	396.151	6 / 2	3.5	Yes
180071	CHEMBL2392156	C18H10F3NO5	377.275	8 / 2	3.0	Yes
182961	CHEMBL2392147	C14H11NO7	305.242	7 / 2	1.0	Yes
198363	CHEMBL2392158	C17H10BrNO5	388.173	5 / 2	2.8	Yes
199309	CHEMBL2392181	C20H17NO6	367.357	6 / 2	3.0	Yes
205382	CHEMBL2392165	C18H12ClNO5	357.746	5 / 2	3.1	Yes
209500	CHEMBL2392170	C17H9BrClNO5	422.615	5 / 2	3.4	Yes
222255	CHEMBL2392176	C18H12BrNO6	418.199	6 / 2	2.8	Yes
241422	CHEMBL2392179	C18H11BrClNO6	452.641	6 / 2	3.4	Yes
251335	CHEMBL2392157	C18H13NO6	339.303	6 / 2	2.1	Yes
254226	CHEMBL2392145	C12H9NO5	247.206	5 / 2	0.5	Yes
265498	CHEMBL2392144	C10H6BrNO4	284.065	5 / 2	1.3	Yes
276586	CHEMBL2392149	C17H11NO5	309.277	5 / 2	2.1	Yes
294555	zaprinast	C13H13N5O2	271.28	5 / 2	1.6	Yes
308862	CHEMBL2392163	C20H16FNO6	385.347	7 / 1	2.9	Yes
309710	CHEMBL2392171	C17H8BrCl2NO5	457.057	5 / 2	4.1	Yes
326051	CHEMBL2392141	C17H11FN2O3S	342.344	6 / 2	3.7	Yes
331192	CHEMBL2392174	C18H12BrNO6	418.199	6 / 2	2.8	Yes
356874	CHEMBL2392146	C13H11NO5	261.233	5 / 2	0.9	Yes
357694	CROMOLYN SODIUM	C23H14Na2O11	512.334	11 / 1	N/A	No
373142	CHEMBL2392153	C18H13NO5	323.304	5 / 2	2.5	Yes
394825	CHEMBL2392180	C21H17NO6	379.368	6 / 2	2.8	Yes
404640	CHEMBL2392155	C18H13NO5	323.304	5 / 2	2.5	Yes
405717	8-amino-2-carboxychromone	C10H7NO4	205.169	5 / 2	0.9	Yes
407844	CHEMBL2392172	C17H8BrCl2NO5	457.057	5 / 2	4.1	Yes
413675	CHEMBL2392167	C18H12ClNO6	373.745	6 / 2	2.7	Yes
421748	CHEMBL2392177	C19H14BrNO7	448.225	7 / 2	2.7	Yes
441045	CHEMBL2392168	C17H10BrNO5	388.173	5 / 2	2.8	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417