Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●ATGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●TM-search ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●rMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●HPmod ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Probable G-protein coupled receptor 88
Species	Homo sapiens (Human)
Gene	GPR88
Synonym	GPR88 STRG striatum-specific G-protein coupled receptor
Disease	N/A
Length	384
Amino acid sequence	MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRVHYPALLAAAALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAAAVAATAVPAVSQAQLGTRAAGQHW
UniProt	Q9GZN0
Protein Data Bank	N/A
GPCR-HGmod model	Q9GZN0
3D structure model	This predicted structure model is from GPCR-EXP Q9GZN0.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL3399910
IUPHAR	123
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
442008	CHEMBL3403789	C22H30N2O3	370.493	4 / 2	3.9	Yes
547984	CHEMBL3884899	C24H33NO3	383.532	3 / 2	4.8	Yes
442343	CHEMBL3400281	C31H39N3O	469.673	3 / 1	5.4	No
548096	CHEMBL3884736	C23H28FNO4	401.478	5 / 1	5.1	No
522035	SCHEMBL2505806	C24H25NO2S	391.529	3 / 2	4.4	Yes
442496	CHEMBL3400274	C31H36N2O3	484.64	4 / 1	5.4	No
442507	CHEMBL3400232	C26H30N2OS	418.599	3 / 1	5.2	No
442540	CHEMBL3403784	C27H38N2O2	422.613	3 / 1	6.0	No
442716	CHEMBL3400282	C30H37N3O	455.646	3 / 2	4.9	Yes
522413	SCHEMBL2502387	C22H30N2O2S	386.554	4 / 2	3.7	Yes
442803	CHEMBL3403786	C22H28FNO3	373.468	4 / 2	4.3	Yes
442897	CHEMBL3403770	C21H27NO4	357.45	4 / 2	2.8	Yes
536861	CHEMBL3884002	C23H30N4O2	394.519	4 / 1	6.3	No
443137	CHEMBL3400221	C28H30F2N2O	448.558	4 / 1	5.8	No
443395	CHEMBL3400270	C29H31F3N2O2	496.574	6 / 1	6.7	No
522942	CHEMBL3714828	C34H38F7N3O6	717.682	15 / 3	N/A	No
443826	CHEMBL3400247	C28H36N2O	416.609	2 / 1	5.7	No
443907	CHEMBL3400229	C26H30N4O	414.553	4 / 1	3.8	Yes
523175	SCHEMBL2502024	C25H27NO3S	421.555	4 / 2	4.3	Yes
444056	CHEMBL3400255	C28H31FN2O	430.567	3 / 1	5.7	No
444161	CHEMBL3400238	C28H32N2O	412.577	2 / 1	5.6	No
444220	CHEMBL3400273	C29H34N2O2	442.603	3 / 2	4.7	Yes
523445	SCHEMBL2522996	C28H39N3O3	465.638	4 / 3	4.9	Yes
444247	CHEMBL3403787	C23H31NO4	385.504	4 / 2	4.2	Yes
444279	CHEMBL3400216	C29H34N2O	426.604	2 / 1	5.9	No
523493	SCHEMBL2519721	C27H39N3O3	453.627	4 / 3	4.8	Yes
444325	CHEMBL3400284	C29H35N3O2	457.618	4 / 1	4.2	Yes
444326	CHEMBL3401459	C29H35N3O2	457.618	4 / 1	4.2	Yes
548688	CHEMBL3884102	C23H33ClN2O2	404.979	3 / 3	N/A	N/A
444382	CHEMBL3403779	C25H35NO3	397.559	3 / 2	5.4	No
523629	SCHEMBL2519803	C29H38N4O3S	522.708	6 / 3	4.9	No
523697	SCHEMBL2519497	C28H41N3O3	467.654	4 / 3	5.2	No
523752	SCHEMBL2520410	C28H39N3O3	465.638	4 / 3	4.6	Yes
523757	CHEMBL3718508	C22H29NO3S	387.538	4 / 2	4.1	Yes
444697	CHEMBL3400219	C28H38N2O	418.625	2 / 1	6.8	No
444704	CHEMBL3403790	C18H21NO3	299.37	3 / 2	2.5	Yes
444758	CHEMBL3400235	C26H31N3OS	433.614	4 / 1	5.0	Yes
523858	CHEMBL3718796	C30H33F4N3O3	559.606	9 / 2	N/A	No
444948	CHEMBL3400230	C25H29N3OS	419.587	4 / 1	4.6	Yes
445050	CHEMBL3403780	C23H32N2O2	368.521	3 / 2	4.5	Yes
445169	CHEMBL3403765	C23H23NO2S	377.502	3 / 2	3.9	Yes
524037	SCHEMBL2501535	C23H23NO2S	377.502	3 / 2	3.9	Yes
524097	SCHEMBL2521040	C25H36N2O2	396.575	3 / 2	5.4	No
445285	CHEMBL3400263	C31H38N2O	454.658	2 / 1	6.9	No
445311	CHEMBL3403793	C22H30N2O2	354.494	3 / 2	4.0	Yes
524136	SCHEMBL2524718	C29H37N3O2	459.634	4 / 2	5.4	No
524144	SCHEMBL2497363	C25H33NO4	411.542	4 / 2	4.2	Yes
445407	CHEMBL3403783	C27H38N2O3	438.612	4 / 1	5.1	No
445495	CHEMBL3404049	C28H34N2O	414.593	2 / 1	6.2	No
445558	CHEMBL3403771	C21H27NO4	357.45	4 / 2	2.8	Yes
445566	CHEMBL3400233	C26H30N2O2	402.538	3 / 1	4.6	Yes
445572	CHEMBL3400198	C27H30N2O2	414.549	3 / 1	4.2	Yes
445685	CHEMBL3400276	C31H36N2O3	484.64	4 / 1	5.8	No
524580	SCHEMBL2522186	C26H39N3O2	425.617	4 / 3	4.5	Yes
524654	CHEMBL3716470	C30H36F7N3O6	667.622	15 / 3	N/A	No
445954	CHEMBL3403772	C23H31NO3	369.505	3 / 2	4.8	Yes
445955	CHEMBL3403768	C23H31NO3	369.505	3 / 2	4.8	Yes
445978	CHEMBL3400217	C29H31N3O	437.587	3 / 1	5.3	No
524707	CHEMBL3718798	C23H31NO3S	401.565	4 / 2	4.5	Yes
446139	CHEMBL3400280	C30H35N3O2	469.629	3 / 2	4.7	Yes
446218	CHEMBL3400241	C27H31N3O	413.565	3 / 1	4.5	Yes
446247	CHEMBL3403781	C25H36N2O2	396.575	3 / 1	5.5	No
446712	CHEMBL3400250	C29H34N2O	426.604	2 / 1	5.9	No
549503	CHEMBL3884939	C24H31NO5	413.514	5 / 1	4.9	Yes
446913	CHEMBL3400266	C31H38N2O2	470.657	3 / 1	6.3	No
447084	CHEMBL3400240	C27H31N3O	413.565	3 / 1	4.5	Yes
549731	CHEMBL3884316	C23H31NO3	369.505	3 / 2	4.5	Yes
525820	CHEMBL3718084	C34H36F7N3O5	699.667	14 / 3	N/A	No
447631	CHEMBL3404053	C30H34N2O2	454.614	2 / 1	5.8	No
447639	CHEMBL3400150	C29H34N2O2	442.603	3 / 1	5.5	No
447742	CHEMBL3400201	C28H32N2O	412.577	2 / 1	5.6	No
447778	CHEMBL3403777	C23H32N2O3	384.52	4 / 3	3.9	Yes
447800	CHEMBL3400244	C26H30N2O2	402.538	3 / 1	4.6	Yes
447880	CHEMBL3400243	C26H30N2OS	418.599	3 / 1	5.3	No
447943	CHEMBL3403773	C24H31NO3	381.516	3 / 2	4.4	Yes
448034	CHEMBL3400228	C26H30N4O	414.553	4 / 1	3.9	Yes
448128	CHEMBL3400256	C28H31FN2O	430.567	3 / 1	5.7	No
448170	CHEMBL3400226	C27H31N3O	413.565	3 / 1	4.5	Yes
448468	CHEMBL3400267	C30H36N2O2	456.63	3 / 1	5.9	No
526484	SCHEMBL2523601	C29H43N3O3	481.681	4 / 3	5.6	No
526485	SCHEMBL2518287	C29H43N3O3	481.681	4 / 3	5.6	No
526486	SCHEMBL2522770	C29H43N3O3	481.681	4 / 3	5.6	No
526487	SCHEMBL2522368	C29H43N3O3	481.681	4 / 3	5.6	No
448664	CHEMBL3400249	C29H34N2O	426.604	2 / 1	5.9	No
526770	SCHEMBL2523616	C23H31NO3	369.505	3 / 2	4.6	Yes
449004	CHEMBL3400234	C26H31N3OS	433.614	4 / 1	5.0	Yes
449119	CHEMBL3400248	C29H34N2O	426.604	2 / 1	5.9	No
526928	CHEMBL3719007	C32H34F3N3O3	565.637	8 / 2	N/A	No
449136	CHEMBL3403785	C23H31NO3	369.505	3 / 2	4.6	Yes
449243	CHEMBL3400206	C29H34N2O	426.604	2 / 1	6.0	No
449576	CHEMBL3401460	C30H37N3O2	471.645	4 / 1	5.3	No
550418	CHEMBL3883525	C24H28N2O4	408.498	5 / 1	4.7	Yes
449692	CHEMBL3400203	C29H34N2O	426.604	2 / 1	5.9	No
527415	SCHEMBL2502436	C21H28N2O2S	372.527	4 / 2	3.4	Yes
449754	CHEMBL3400260	C28H31ClN2O	447.019	2 / 1	6.2	No
449763	CHEMBL3400253	C29H34N2O2	442.603	3 / 1	5.5	No
527588	CHEMBL3714801	C34H36F7N3O6	715.666	15 / 3	N/A	No
550550	CHEMBL3885410	C25H34N2O3	410.558	3 / 1	5.1	No
527880	SCHEMBL2517768	C28H41N3O3	467.654	4 / 3	5.1	No
527881	SCHEMBL2522360	C28H41N3O3	467.654	4 / 3	5.1	No

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417